Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NFKBIASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NFKBIA Polyclonal Antibody | anti-NFKBIA antibody

NFKBIA Antibody - N-terminal region

Gene Names
NFKBIA; IKBA; MAD-3; NFKBI; EDAID2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NFKBIA; Polyclonal Antibody; NFKBIA Antibody - N-terminal region; anti-NFKBIA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLT
Sequence Length
317
Applicable Applications for anti-NFKBIA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NFKBIA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NFKBIASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NFKBIASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NFKBIA antibody
This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease.
Product Categories/Family for anti-NFKBIA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
NF-kappa-B inhibitor alpha
NCBI Official Synonym Full Names
NFKB inhibitor alpha
NCBI Official Symbol
NFKBIA
NCBI Official Synonym Symbols
IKBA; MAD-3; NFKBI; EDAID2
NCBI Protein Information
NF-kappa-B inhibitor alpha
UniProt Protein Name
NF-kappa-B inhibitor alpha
Protein Family
UniProt Gene Name
NFKBIA
UniProt Synonym Gene Names
IKBA; MAD3; NFKBI; IkB-alpha
UniProt Entry Name
IKBA_HUMAN

NCBI Description

This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011]

Uniprot Description

IkB-alpha: a regulatory protein that inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. May be involved in regulation of transcriptional responses to NF-kappa-B, including cell adhesion, immune and proinflammatory responses, apoptosis, differentiation and growth. Controlled by sequential serine-phosphorylation, ubiquitination and degradation.

Protein type: Inhibitor; DNA-binding

Chromosomal Location of Human Ortholog: 14q13

Cellular Component: cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: identical protein binding; NF-kappaB binding; protein binding; enzyme binding; ubiquitin protein ligase binding; heat shock protein binding; nuclear localization sequence binding; protein complex binding; transcription factor binding

Biological Process: nerve growth factor receptor signaling pathway; viral reproduction; apoptosis; positive regulation of cellular protein metabolic process; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; cytoplasmic sequestering of NF-kappaB; response to exogenous dsRNA; lipopolysaccharide-mediated signaling pathway; positive regulation of interferon type I production; toll-like receptor 4 signaling pathway; cytoplasmic sequestering of transcription factor; negative regulation of myeloid cell differentiation; MyD88-independent toll-like receptor signaling pathway; negative regulation of DNA binding; regulation of NF-kappaB import into nucleus; toll-like receptor 2 signaling pathway; regulation of cell proliferation; MyD88-dependent toll-like receptor signaling pathway; response to muramyl dipeptide; protein import into nucleus, translocation; inhibition of NF-kappaB transcription factor; toll-like receptor signaling pathway; negative regulation of Notch signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of apoptosis

Disease: Ectodermal Dysplasia, Anhidrotic, With T-cell Immunodeficiency, Autosomal Dominant

Research Articles on NFKBIA

Similar Products

Product Notes

The NFKBIA nfkbia (Catalog #AAA3224185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKBIA Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFKBIA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFKBIA nfkbia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KERLLDDRHD SGLDSMKDEE YEQMVKELQE IRLEPQEVPR GSEPWKQQLT. It is sometimes possible for the material contained within the vial of "NFKBIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.