Western Blot (WB)
(Host: RabbitTarget Name: GBA2Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Rabbit GBA2 Polyclonal Antibody | anti-GBA2 antibody
GBA2 Antibody - middle region
Gene Names
Gba2; F630034E04
Reactivity
Tested Species/Predicted species Reactivity: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
GBA2; Polyclonal Antibody; GBA2 Antibody - middle region; anti-GBA2 antibody
Host
Rabbit
Reactivity
Tested Species/Predicted species Reactivity: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVL
Sequence Length
918
Applicable Applications for anti-GBA2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse GBA2
Protein Size (#AA)
918 amino acids
Blocking Peptide
For anti-GBA2 (MBS3223754) antibody is (MBS3248358)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GBA2Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GBA2Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GBA2 antibody
Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide (GlcCer) to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo. Plays a role in central nevous system development (By similarity). Required for proper formation of motor neuron axons (By similarity).
Product Categories/Family for anti-GBA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103 kDa
NCBI Official Full Name
non-lysosomal glucosylceramidase
NCBI Official Synonym Full Names
glucosidase beta 2
NCBI Official Symbol
Gba2
NCBI Official Synonym Symbols
F630034E04
NCBI Protein Information
non-lysosomal glucosylceramidase
UniProt Protein Name
Non-lysosomal glucosylceramidase
UniProt Gene Name
Gba2
UniProt Synonym Gene Names
Kiaa1605; NLGase; Beta-glucosidase 2
UniProt Entry Name
GBA2_MOUSE
Research Articles on GBA2
Similar Products
Product Notes
The GBA2 gba2 (Catalog #AAA3223754) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GBA2 Antibody - middle region reacts with Tested Species/Predicted species Reactivity: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GBA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GBA2 gba2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMSGVVAPVK RRNVIPHDIG DPDDEPWLRV NAYLIHDTAD WKDLNLKFVL. It is sometimes possible for the material contained within the vial of "GBA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
