Rabbit anti-Mouse DDX58 Polyclonal Antibody | anti-DDX58 antibody

DDX58 Antibody - middle region

Cat. Num. AAA3223677

• Gene Names: Ddx58; RIG-I; RLR-1; C330021E21; 6430573D20Rik
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: DDX58; Polyclonal Antibody; DDX58 Antibody - middle region; anti-DDX58 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREFGTQKYEQWI
• Sequence Length: 472

• Applicable Applications for anti-DDX58 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse DDX58
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DDX58Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-DDX58 antibody

Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include: 5'-triphosphorylated ssRNA and dsRNA and short dsRNA (<1 kb in length). In addition to the 5'-triphosphate moiety, blunt-end base pairing at the 5'-end of the RNA is very essential. Overhangs at the non-triphosphorylated end of the dsRNA RNA have no major impact on its activity. A 3'overhang at the 5'triphosphate end decreases and any 5'overhang at the 5' triphosphate end abolishes its activity. Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Detects both positive and negative strand RNA viruses including members of the families Paramyxoviridae: newcastle disease virus (NDV) and Sendai virus (SeV), Rhabdoviridae: vesicular stomatitis virus (VSV), Orthomyxoviridae: influenza A and B virus, Flaviviridae: Japanese encephalitis virus (JEV), hepatitis C virus (HCV), dengue virus (DENV) and west Nile virus (WNV). It also detects rotavirus and orthoreovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome such as Epstein-Barr virus (EBV). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). May play important roles in granulocyte production and differentiation, bacterial phagocytosis and in the regulation of cell migration.

Product Categories/Family for anti-DDX58 antibody

Polyclonal; Signaling Intermediate; Immunology; Mitochondria; Disease Related; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 153945886
• NCBI GeneID: 230073
• NCBI Accession #: NP_766277.3
• NCBI GenBank Nucleotide #: NM_172689.3
• UniProt Accession #: Q6Q899
• Molecular Weight: 51 kDa
• NCBI Official Full Name: probable ATP-dependent RNA helicase DDX58
• NCBI Official Synonym Full Names: DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
• NCBI Official Symbol: Ddx58
• NCBI Official Synonym Symbols: RIG-I; RLR-1; C330021E21; 6430573D20Rik
• NCBI Protein Information: probable ATP-dependent RNA helicase DDX58
• UniProt Protein Name: Probable ATP-dependent RNA helicase DDX58
• Protein Family: Probable ATP-dependent RNA helicase
• UniProt Gene Name: Ddx58
• UniProt Synonym Gene Names: RLR-1; RIG-1; RIG-I
• UniProt Entry Name: DDX58_MOUSE

Uniprot Description

DDX58: an innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include: 5'- triphosphorylated ssRNA and dsRNA and short dsRNA (<1 kb in length). In addition to the 5'-triphosphate moiety, blunt-end base pairing at the 5'-end of the RNA is very essential. Overhangs at the non-triphosphorylated end of the dsRNA RNA have no major impact on its activity. A 3'overhang at the 5'triphosphate end decreases and any 5'overhang at the 5' triphosphate end abolishes its activity. Upon ligand binding it associates with mitochondria antiviral signaling protein MAVS which activates the IKK- related kinases TBK1 and IKBKE which phosphorylate interferon regulatory factors IRF3 and IRF7, in turn activating transcription of antiviral immunological genes, including IFN-alpha and IFN-beta. Detects both positive and negative strand RNA viruses including members of the families Paramyxoviridae: Human respiratory synctial virus and measles virus (MeV), Rhabdoviridae: vesicular stomatitis virus (VSV), Orthomyxoviridae: influenza A and B virus, Flaviviridae: Japanese encephalitis virus (JEV), hepatitis C virus (HCV), dengue virus (DENV) and west Nile virus (WNV). It also detects rotavirus and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome such as Epstein-Barr virus (EBV). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). May play important roles in granulocyte production and differentiation, bacterial phagocytosis and in the regulation of cell migration. Maintained as a monomer in an autoinhibited state. Upon viral dsRNA binding and conformation shift, homomultimerizes and interacts with MAVS. Interacts with DHX58, IKBKE, TBK1 and STING. Interacts (via CARD domain) with TRIM25 (via SPRY domain). Interacts with RNF135. Interacts with CYLD. Interacts with NLRC5; blocks the interaction of MAVS to DDX58. Interacts with SRC. Interacts with protein Z of Guanarito virus, Machupo virus, Junin arenavirus and Sabia virus. This interaction disrupts its interaction with MAVS, impeding downstream IRF3 and NF-kappa-B activation and resulting in decreased IFN-beta induction. Interacts (via CARD domain) with Human respiratory syncytial virus A non-structural protein 2 (NS2) and this interaction disrupts its interaction with MAVS, impeding downstream IRF3 activation. Present in vascular smooth cells. Belongs to the helicase family. RLR subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; EC 3.6.4.13

Cellular Component: cytoskeleton; cell projection; tight junction; membrane; cytoplasm; plasma membrane; cell junction; actin cytoskeleton

Molecular Function: identical protein binding; protein binding; hydrolase activity, acting on acid anhydrides; single-stranded RNA binding; nucleic acid binding; hydrolase activity; zinc ion binding; RNA binding; metal ion binding; double-stranded RNA binding; double-stranded DNA binding; nucleotide binding; helicase activity; ATP binding

Biological Process: response to exogenous dsRNA; detection of virus; immune system process; response to virus; positive regulation of transcription factor import into nucleus; positive regulation of interferon-beta production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of defense response to virus by host; regulation of cell migration; defense response to virus; positive regulation of interferon-alpha production