Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SRMSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse SRM Polyclonal Antibody | anti-SRM antibody

SRM Antibody - middle region

Gene Names
Srm; SpdST; SpdSy; AA407669
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SRM; Polyclonal Antibody; SRM Antibody - middle region; anti-SRM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGEC
Sequence Length
302
Applicable Applications for anti-SRM antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse SRM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SRMSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SRMSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SRM antibody
Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine (By similarity).
Product Categories/Family for anti-SRM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
spermidine synthase
NCBI Official Synonym Full Names
spermidine synthase
NCBI Official Symbol
Srm
NCBI Official Synonym Symbols
SpdST; SpdSy; AA407669
NCBI Protein Information
spermidine synthase
UniProt Protein Name
Spermidine synthase
UniProt Gene Name
Srm
UniProt Synonym Gene Names
SPDSY

Uniprot Description

SRM: Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine. Belongs to the spermidine/spermine synthase family.

Protein type: Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - cysteine and methionine; EC 2.5.1.16; Other Amino Acids Metabolism - beta-alanine; Other Amino Acids Metabolism - glutathione; Transferase

Chromosomal Location of Human Ortholog: 4|4 E2

Molecular Function: catalytic activity; identical protein binding; protein homodimerization activity; spermidine synthase activity; transferase activity

Biological Process: polyamine biosynthetic process; polyamine metabolic process; spermidine biosynthetic process

Research Articles on SRM

Similar Products

Product Notes

The SRM srm (Catalog #AAA3223566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRM Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SRM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SRM srm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKQNQDAFDV IITDSSDPMG PAESLFKESY YQLMKTALKE DGILCCQGEC. It is sometimes possible for the material contained within the vial of "SRM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.