Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HSH2DSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HSH2D Polyclonal Antibody | anti-HSH2D antibody

HSH2D Antibody - middle region

Gene Names
HSH2D; ALX; HSH2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HSH2D; Polyclonal Antibody; HSH2D Antibody - middle region; anti-HSH2D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TQPCRQKDPANVDYEDLFLYSNAVAEEAACPVSAPEEASPKPVLCHQSKE
Sequence Length
295
Applicable Applications for anti-HSH2D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HSH2D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HSH2DSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HSH2DSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSH2D antibody
T-cell activation requires 2 signals: recognition of antigen by the T-cell receptor and a costimulatory signal provided primarily by CD28 in naive T cells. HSH2 is a target of both of these signaling pathways.
Product Categories/Family for anti-HSH2D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
hematopoietic SH2 domain-containing protein isoform 2
NCBI Official Synonym Full Names
hematopoietic SH2 domain containing
NCBI Official Symbol
HSH2D
NCBI Official Synonym Symbols
ALX; HSH2
NCBI Protein Information
hematopoietic SH2 domain-containing protein
UniProt Protein Name
Hematopoietic SH2 domain-containing protein
UniProt Gene Name
HSH2D
UniProt Synonym Gene Names
ALX; Hematopoietic SH2 protein
UniProt Entry Name
HSH2D_HUMAN

NCBI Description

T-cell activation requires 2 signals: recognition of antigen by the T-cell receptor (see TCR; MIM 186880) and a costimulatory signal provided primarily by CD28 (MIM 186760) in naive T cells. HSH2 is a target of both of these signaling pathways (Greene et al., 2003 [PubMed 12960172]).[supplied by OMIM, Mar 2008]

Research Articles on HSH2D

Similar Products

Product Notes

The HSH2D hsh2d (Catalog #AAA3223326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSH2D Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSH2D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSH2D hsh2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQPCRQKDPA NVDYEDLFLY SNAVAEEAAC PVSAPEEASP KPVLCHQSKE. It is sometimes possible for the material contained within the vial of "HSH2D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.