Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SMC1ASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SMC1A Polyclonal Antibody | anti-SMC1A antibody

SMC1A Antibody - C-terminal region

Gene Names
SMC1A; SMC1; SMCB; CDLS2; SB1.8; SMC1L1; DXS423E; SMC1alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SMC1A; Polyclonal Antibody; SMC1A Antibody - C-terminal region; anti-SMC1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
Sequence Length
1233
Applicable Applications for anti-SMC1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SMC1ASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SMC1ASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SMC1A antibody
Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1B or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Mutations in this gene result in Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
143 kDa
NCBI Official Full Name
structural maintenance of chromosomes protein 1A isoform 1
NCBI Official Synonym Full Names
structural maintenance of chromosomes 1A
NCBI Official Symbol
SMC1A
NCBI Official Synonym Symbols
SMC1; SMCB; CDLS2; SB1.8; SMC1L1; DXS423E; SMC1alpha
NCBI Protein Information
structural maintenance of chromosomes protein 1A
UniProt Protein Name
Structural maintenance of chromosomes protein 1A
UniProt Gene Name
SMC1A
UniProt Synonym Gene Names
DXS423E; KIAA0178; SB1.8; SMC1; SMC1L1; SMC protein 1A; SMC-1-alpha; SMC-1A
UniProt Entry Name
SMC1A_HUMAN

NCBI Description

Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1B or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Mutations in this gene result in Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

Smc1: a component of the cohesin multiprotein complex that is required for sister chromatid cohesion. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Thought to be an important part of functional kinetochores. Interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair.

Protein type: RNA splicing; DNA replication

Chromosomal Location of Human Ortholog: Xp11.22-p11.21

Cellular Component: kinetochore; nucleoplasm; cohesin core heterodimer; condensed nuclear chromosome; cytoplasm; nucleolus; chromosome; nucleus; cytosol; chromosome, pericentric region

Molecular Function: protein binding; protein heterodimerization activity; microtubule motor activity; chromatin binding; ATP binding

Biological Process: meiosis; mitotic sister chromatid segregation; mitotic cell cycle checkpoint; RNA splicing; stem cell maintenance; mitotic sister chromatid cohesion; DNA damage response, signal transduction; sister chromatid cohesion; negative regulation of DNA endoreduplication; DNA repair; nuclear mRNA splicing, via spliceosome; response to radiation; mitotic spindle organization and biogenesis; cell division; gene expression; mitotic cell cycle

Disease: Cornelia De Lange Syndrome 2

Research Articles on SMC1A

Similar Products

Product Notes

The SMC1A smc1a (Catalog #AAA3223289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMC1A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMC1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMC1A smc1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIVISLKEEF YTKAESLIGV YPEQGDCVIS KVLTFDLTKY PDANPNPNEQ. It is sometimes possible for the material contained within the vial of "SMC1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.