Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HDGFSample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HDGF Polyclonal Antibody | anti-HDGF antibody

HDGF Antibody - middle region

Gene Names
HDGF; HMG1L2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HDGF; Polyclonal Antibody; HDGF Antibody - middle region; anti-HDGF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQ
Sequence Length
233
Applicable Applications for anti-HDGF antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of Human HDGF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HDGFSample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HDGFSample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HDGF antibody
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
hepatoma-derived growth factor isoform b
NCBI Official Synonym Full Names
heparin binding growth factor
NCBI Official Symbol
HDGF
NCBI Official Synonym Symbols
HMG1L2
NCBI Protein Information
hepatoma-derived growth factor
UniProt Protein Name
Hepatoma-derived growth factor
UniProt Gene Name
HDGF
UniProt Synonym Gene Names
HMG1L2; HDGF; HMG-1L2
UniProt Entry Name
HDGF_HUMAN

NCBI Description

This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2016]

Uniprot Description

HDGF: Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor. Belongs to the HDGF family.

Protein type: Transcription regulation; Cytokine

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: nucleoplasm; extracellular space; transcriptional repressor complex; cytoplasm

Molecular Function: heparin binding; DNA binding; growth factor activity; nucleotide binding

Biological Process: cell proliferation; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; transcription, DNA-dependent; unfolded protein response; negative regulation of transcription from RNA polymerase II promoter; signal transduction

Research Articles on HDGF

Similar Products

Product Notes

The HDGF hdgf (Catalog #AAA3223251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDGF Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDGF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HDGF hdgf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THETAFLGPK DLFPYEESKE KFGKPNKRKG FSEGLWEIEN NPTVKASGYQ. It is sometimes possible for the material contained within the vial of "HDGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.