Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RIT2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RIT2 Polyclonal Antibody | anti-RIT2 antibody

RIT2 Antibody - middle region

Gene Names
RIT2; RIN; RIBA; ROC2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RIT2; Polyclonal Antibody; RIT2 Antibody - middle region; anti-RIT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA
Sequence Length
236
Applicable Applications for anti-RIT2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RIT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RIT2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RIT2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RIT2 antibody
RIN belongs to the RAS superfamily of small GTPases.
Product Categories/Family for anti-RIT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
GTP-binding protein Rit2 isoform 2
NCBI Official Synonym Full Names
Ras like without CAAX 2
NCBI Official Symbol
RIT2
NCBI Official Synonym Symbols
RIN; RIBA; ROC2
NCBI Protein Information
GTP-binding protein Rit2
UniProt Protein Name
GTP-binding protein Rit1
Protein Family
UniProt Gene Name
RIT1
UniProt Synonym Gene Names
RIBB; RIT; ROC1
UniProt Entry Name
RIT1_HUMAN

NCBI Description

RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]

Uniprot Description

RIT1: a small G protein of the Ras family. Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and p38-alpha signaling pathways and in NGF- dependent neuronal differentiation. Stimulation of the NGF and EGF receptor signaling pathways results in rapid and prolonged activation. Interacts with afadin, the C-terminal domain of RalGDS and RLF, but not with RIN1 and PIK3CA. RLF binds exclusively to the active GTP-bound form. Strongly interacts with BRAF, but only weakly with c-Raf. BRAF and c-RAF association is dependent upon the GTP-bound state. Interacts with RGL3. Shows rapid uncatalyzed guanine nucleotide dissociation rates, which are much faster than those of most Ras subfamily members.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Ras

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: plasma membrane

Molecular Function: calmodulin binding; protein binding; GTP binding

Biological Process: nerve growth factor receptor signaling pathway; small GTPase mediated signal transduction; Ras protein signal transduction; signal transduction

Disease: Noonan Syndrome 8

Research Articles on RIT2

Similar Products

Product Notes

The RIT2 rit1 (Catalog #AAA3222664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIT2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIT2 rit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVGKSAMTMQ FISHQFPDYH DPTIEDAYKT QVRIDNEPAY LDILDTAGQA. It is sometimes possible for the material contained within the vial of "RIT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.