Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARHGEF2Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ARHGEF2 Polyclonal Antibody | anti-ARHGEF2 antibody

ARHGEF2 Antibody - C-terminal region

Gene Names
ARHGEF2; GEF; P40; GEFH1; LFP40; GEF-H1; NEDMHM
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ARHGEF2; Polyclonal Antibody; ARHGEF2 Antibody - C-terminal region; anti-ARHGEF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRM
Sequence Length
986
Applicable Applications for anti-ARHGEF2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ARHGEF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARHGEF2Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARHGEF2Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ARHGEF2 antibody
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-ARHGEF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108 kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 2 isoform 1
NCBI Official Synonym Full Names
Rho/Rac guanine nucleotide exchange factor 2
NCBI Official Symbol
ARHGEF2
NCBI Official Synonym Symbols
GEF; P40; GEFH1; LFP40; GEF-H1; NEDMHM
NCBI Protein Information
rho guanine nucleotide exchange factor 2
UniProt Protein Name
Rho guanine nucleotide exchange factor 2
UniProt Gene Name
ARHGEF2
UniProt Synonym Gene Names
KIAA0651; LFP40; GEF-H1
UniProt Entry Name
ARHG2_HUMAN

NCBI Description

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Jun 2009]

Uniprot Description

ARHGEF2: a microtubule-associated guanine nucleotide exchange factor for Rac and Rho GTPases. Mediates cross-talk between microtubules and the actin cytoskeleton. Contains a phorbol esters/diacylglycerol binding and PH domain.

Protein type: GEFs, Rac/Rho; GEFs; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: Golgi apparatus; microtubule; protein complex; tight junction; cytoskeleton; focal adhesion; cell soma; cytoplasmic membrane-bound vesicle; cytoplasm; spindle; dendritic shaft; cytosol; vesicle

Molecular Function: Rho guanyl-nucleotide exchange factor activity; protein binding; Rho GTPase binding; zinc ion binding; Rac guanyl-nucleotide exchange factor activity; microtubule binding; Rac GTPase binding; transcription factor binding

Biological Process: mitosis; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; negative regulation of microtubule depolymerization; cell morphogenesis; positive regulation of interleukin-6 production; actin filament organization; positive regulation of tumor necrosis factor production; regulation of cell proliferation; negative regulation of neurogenesis; activation of NF-kappaB transcription factor; intracellular protein transport; regulation of small GTPase mediated signal transduction; positive regulation of peptidyl-tyrosine phosphorylation; establishment of mitotic spindle orientation; cell division; small GTPase mediated signal transduction; regulation of Rho protein signal transduction; innate immune response; positive regulation of transcription from RNA polymerase II promoter

Research Articles on ARHGEF2

Similar Products

Product Notes

The ARHGEF2 arhgef2 (Catalog #AAA3222445) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGEF2 arhgef2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VHRNFEDRER QELGSPEERL QDSSDPDTGS EEEGSSRLSP PHSPRDFTRM. It is sometimes possible for the material contained within the vial of "ARHGEF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.