Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CALCASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CALCA Polyclonal Antibody | anti-CALCA antibody

CALCA Antibody - middle region

Gene Names
CALCA; CT; KC; PCT; CGRP; CALC1; CGRP1; CGRP-I
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CALCA; Polyclonal Antibody; CALCA Antibody - middle region; anti-CALCA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQN
Sequence Length
141
Applicable Applications for anti-CALCA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CALCA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CALCASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CALCASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CALCA antibody
This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
796
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa
NCBI Official Full Name
calcitonin isoform CT preproprotein
NCBI Official Synonym Full Names
calcitonin related polypeptide alpha
NCBI Official Symbol
CALCA
NCBI Official Synonym Symbols
CT; KC; PCT; CGRP; CALC1; CGRP1; CGRP-I
NCBI Protein Information
calcitonin; calcitonin gene-related peptide 1
UniProt Protein Name
Calcitonin
Protein Family
UniProt Gene Name
CALCA
UniProt Synonym Gene Names
CALC1; CCP
UniProt Entry Name
CALC_HUMAN

NCBI Description

This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2014]

Uniprot Description

CALCA: Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. Belongs to the calcitonin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: extracellular space; cell soma; cytoplasm; extracellular region; terminal button; nucleus

Molecular Function: identical protein binding; protein binding; calcitonin receptor binding; hormone activity; protein complex binding; receptor binding

Biological Process: negative regulation of osteoclast differentiation; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of interleukin-1 alpha production; vasodilation of artery during baroreceptor response to increased systemic arterial blood pressure; response to pain; positive regulation of vasodilation; protein amino acid phosphorylation; G-protein signaling, adenylate cyclase activating pathway; positive regulation of interleukin-8 production; monocyte chemotaxis; elevation of cytosolic calcium ion concentration; leukocyte adhesion; cell-cell signaling; vasculature development; neuropeptide signaling pathway; negative regulation of smooth muscle contraction; receptor internalization; regulation of blood pressure; positive regulation of cAMP biosynthetic process; negative regulation of ossification; feeding behavior; negative regulation of blood pressure; positive regulation of adenylate cyclase activity; positive regulation of macrophage differentiation; negative regulation of bone resorption; detection of temperature stimulus involved in sensory perception of pain; inflammatory response; negative regulation of neurological process; aging; cytosolic calcium ion homeostasis; regulation of heart rate; adenylate cyclase activation; positive regulation of ossification; regulation of systemic arterial blood pressure by neurological process; G-protein coupled receptor internalization; response to heat; endothelial cell proliferation; regulation of inflammatory response; activation of protein kinase activity; endothelial cell migration; negative regulation of transcription, DNA-dependent; embryo implantation

Research Articles on CALCA

Similar Products

Product Notes

The CALCA calca (Catalog #AAA3222442) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALCA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CALCA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CALCA calca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TCMLGTYTQD FNKFHTFPQT AIGVGAPGKK RDMSSDLERD HRPHVSMPQN. It is sometimes possible for the material contained within the vial of "CALCA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.