Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GGA1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GGA1 Polyclonal Antibody | anti-GGA1 antibody

GGA1 Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GGA1; Polyclonal Antibody; GGA1 Antibody - C-terminal region; anti-GGA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGS
Sequence Length
639
Applicable Applications for anti-GGA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GGA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GGA1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GGA1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GGA1 antibody
This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GGA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
ADP-ribosylation factor-binding protein GGA1 isoform 2
NCBI Official Synonym Full Names
golgi associated, gamma adaptin ear containing, ARF binding protein 1
NCBI Official Symbol
GGA1
NCBI Protein Information
ADP-ribosylation factor-binding protein GGA1
UniProt Protein Name
ADP-ribosylation factor-binding protein GGA1
UniProt Gene Name
GGA1
UniProt Entry Name
GGA1_HUMAN

NCBI Description

This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GGA1: Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF- dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif. Belongs to the GGA protein family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: nucleoplasm; Golgi apparatus; clathrin adaptor complex; intracellular membrane-bound organelle; membrane; endosome membrane

Molecular Function: protein binding

Biological Process: vesicle-mediated transport; intracellular protein transport; positive regulation of protein catabolic process

Research Articles on GGA1

Similar Products

Product Notes

The GGA1 gga1 (Catalog #AAA3222438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GGA1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GGA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GGA1 gga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSAITQVLLL ANPQKEKVRL RYKLTFTMGD QTYNEMGDVD QFPPPETWGS. It is sometimes possible for the material contained within the vial of "GGA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.