Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NUBP1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NUBP1 Polyclonal Antibody | anti-NUBP1 antibody

NUBP1 Antibody - middle region

Gene Names
NUBP1; NBP; NBP1; CIAO5; NBP35
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NUBP1; Polyclonal Antibody; NUBP1 Antibody - middle region; anti-NUBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLI
Sequence Length
309
Applicable Applications for anti-NUBP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NUBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NUBP1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NUBP1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NUBP1 antibody
NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins.
Product Categories/Family for anti-NUBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
cytosolic Fe-S cluster assembly factor NUBP1 isoform 2
NCBI Official Synonym Full Names
nucleotide binding protein 1
NCBI Official Symbol
NUBP1
NCBI Official Synonym Symbols
NBP; NBP1; CIAO5; NBP35
NCBI Protein Information
cytosolic Fe-S cluster assembly factor NUBP1
UniProt Protein Name
Cytosolic Fe-S cluster assembly factor NUBP1
UniProt Gene Name
NUBP1
UniProt Synonym Gene Names
NBP 1
UniProt Entry Name
NUBP1_HUMAN

NCBI Description

NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).[supplied by OMIM, Mar 2008]

Uniprot Description

NUBP1: Implicated in the regulation of centrosome duplication. Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins. Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 16p13.13

Cellular Component: cytoplasm; cytosol; plasma membrane

Molecular Function: iron-sulfur cluster binding; nucleotide binding; protein binding

Biological Process: cell growth; cellular iron ion homeostasis; iron-sulfur cluster assembly

Research Articles on NUBP1

Similar Products

Product Notes

The NUBP1 nubp1 (Catalog #AAA3222004) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUBP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUBP1 nubp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYVEDNLGVM SVGFLLSSPD DAVIWRGPKK NGMIKQFLRD VDWGEVDYLI. It is sometimes possible for the material contained within the vial of "NUBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.