Western Blot (WB)
(Host: RabbitTarget Name: TOMM70ASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human TOMM70 Polyclonal Antibody | anti-TOMM70 antibody
TOMM70 Antibody - middle region
Gene Names
TOMM70; Tom70; TOMM70A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TOMM70; Polyclonal Antibody; TOMM70 Antibody - middle region; anti-TOMM70 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLKAKQY
Sequence Length
608
Applicable Applications for anti-TOMM70 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TOMM70A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TOMM70ASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TOMM70ASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TOMM70 antibody
This gene encodes an import receptor of the outer mitochondrial membrane that is part of the translocase of the outer membrane complex. This protein is involved in the import of mitochondrial precursor proteins.
Product Categories/Family for anti-TOMM70 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66 kDa
NCBI Official Full Name
mitochondrial import receptor subunit TOM70
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 70
NCBI Official Symbol
TOMM70
NCBI Official Synonym Symbols
Tom70; TOMM70A
NCBI Protein Information
mitochondrial import receptor subunit TOM70
UniProt Protein Name
Mitochondrial import receptor subunit TOM70
UniProt Gene Name
TOMM70A
UniProt Synonym Gene Names
KIAA0719; TOM70
UniProt Entry Name
TOM70_HUMAN
NCBI Description
This gene encodes an import receptor of the outer mitochondrial membrane that is part of the translocase of the outer membrane complex. This protein is involved in the import of mitochondrial precursor proteins. [provided by RefSeq, Oct 2011]
Uniprot Description
TOMM70A: Receptor that accelerates the import of all mitochondrial precursor proteins. Belongs to the Tom70 family.
Protein type: Receptor, protein translocating; Mitochondrial; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3q12.2
Cellular Component: membrane; mitochondrial outer membrane translocase complex; mitochondrion; integral to membrane
Molecular Function: protein binding; protein transmembrane transporter activity
Biological Process: cellular protein metabolic process; protein targeting to mitochondrion
Research Articles on TOMM70
Similar Products
Product Notes
The TOMM70 tomm70a (Catalog #AAA3221913) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOMM70 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TOMM70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOMM70 tomm70a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFIKSYFSSF TDDIISQPML KGEKSDEDKD KEGEALEVKE NSGYLKAKQY. It is sometimes possible for the material contained within the vial of "TOMM70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
