Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FNIP1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FNIP1 Polyclonal Antibody | anti-FNIP1 antibody

FNIP1 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FNIP1; Polyclonal Antibody; FNIP1 Antibody - middle region; anti-FNIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRSQAVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSE
Sequence Length
1161
Applicable Applications for anti-FNIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FNIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FNIP1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FNIP1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FNIP1 antibody
May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1.
Product Categories/Family for anti-FNIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131 kDa
NCBI Official Full Name
folliculin-interacting protein 1 isoform 2
NCBI Official Synonym Full Names
folliculin interacting protein 1
NCBI Official Symbol
FNIP1
NCBI Protein Information
folliculin-interacting protein 1
UniProt Protein Name
Folliculin-interacting protein 1
UniProt Gene Name
FNIP1
UniProt Synonym Gene Names
KIAA1961
UniProt Entry Name
FNIP1_HUMAN

NCBI Description

This gene encodes a protein that binds to the tumor suppressor protein folliculin and to AMP-activated protein kinase (AMPK). The encoded protein participates in the regulation of cellular metabolism and nutrient sensing by modulating the AMPK and target of rapamycin signaling pathways. This gene has a closely related paralog that encodes a protein with similar binding activities. Both related proteins also associate with the molecular chaperone heat shock protein-90 (Hsp90) and negatively regulate its ATPase activity and facilitate its association with folliculin. [provided by RefSeq, Jul 2017]

Uniprot Description

FNIP1: May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1. Belongs to the FNIP family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 5q23.3

Cellular Component: cytoplasm

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity

Biological Process: regulation of protein amino acid phosphorylation; negative regulation of TOR signaling pathway; TOR signaling pathway; positive regulation of B cell apoptosis; immature B cell differentiation; negative regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; cellular response to starvation; positive regulation of peptidyl-serine phosphorylation; positive regulation of GTPase activity

Research Articles on FNIP1

Similar Products

Product Notes

The FNIP1 fnip1 (Catalog #AAA3221177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FNIP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FNIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FNIP1 fnip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRSQAVVDQI TRHHTKPLKE ERGAIDQHQE TKQTTKDQSG ESDTQNMVSE. It is sometimes possible for the material contained within the vial of "FNIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.