Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAB11FIP4Sample Tissue: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RAB11FIP4 Polyclonal Antibody | anti-RAB11FIP4 antibody

RAB11FIP4 Antibody - C-terminal region

Gene Names
RAB11FIP4; FIP4-Rab11; RAB11-FIP4
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAB11FIP4; Polyclonal Antibody; RAB11FIP4 Antibody - C-terminal region; anti-RAB11FIP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAE
Sequence Length
637
Applicable Applications for anti-RAB11FIP4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB11FIP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAB11FIP4Sample Tissue: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAB11FIP4Sample Tissue: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RAB11FIP4 antibody
Proteins of the large Rab GTPase family (see RAB1A; MIM 179508) have regulatory roles in the formation, targeting, and fusion of intracellular transport vesicles. RAB11FIP4 is one of many proteins that interact with and regulate Rab GTPases (Hales et al., 2001 [PubMed 11495908]).[supplied by OMIM, Apr 2008]
Product Categories/Family for anti-RAB11FIP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
rab11 family-interacting protein 4 isoform 2
NCBI Official Synonym Full Names
RAB11 family interacting protein 4
NCBI Official Symbol
RAB11FIP4
NCBI Official Synonym Symbols
FIP4-Rab11; RAB11-FIP4
NCBI Protein Information
rab11 family-interacting protein 4
UniProt Protein Name
Rab11 family-interacting protein 4
UniProt Gene Name
RAB11FIP4
UniProt Synonym Gene Names
ARFO2; KIAA1821; FIP4-Rab11; Rab11-FIP4
UniProt Entry Name
RFIP4_HUMAN

NCBI Description

The protein encoded by this gene interacts with RAB11 and is thought to be involved in bringing recycling endosome membranes to the cleavage furrow in late cytokinesis. Hypoxic conditions can lead to an upregulation of the encoded protein and enhance the metastatic potential of hepatocellular carcinoma. [provided by RefSeq, Oct 2016]

Uniprot Description

RAB11FIP4: Acts as a regulator of endocytic traffic by participating in membrane delivery. Required for the abcission step in cytokinesis, possibly by acting as an 'address tag' delivering recycling endosome membranes to the cleavage furrow during late cytokinesis. In case of infection by HCMV (human cytomegalovirus), may participate in egress of the virus out of nucleus; this function is independent of ARF6. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cleavage furrow; endocytic vesicle; endosome; extracellular space; microtubule organizing center; midbody; recycling endosome membrane; spindle

Molecular Function: ADP-ribosylation factor binding; calcium ion binding; protein binding; protein homodimerization activity; Rab GTPase binding

Biological Process: cytokinesis; transport; viral reproduction

Research Articles on RAB11FIP4

Similar Products

Product Notes

The RAB11FIP4 rab11fip4 (Catalog #AAA3220970) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB11FIP4 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB11FIP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB11FIP4 rab11fip4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEHEVKRLKQ ENYKLRDQND DLNGQILSLS LYEAKNLFAA QTKAQSLAAE. It is sometimes possible for the material contained within the vial of "RAB11FIP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.