Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: GNAT3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit anti-Human GNAT3 Polyclonal Antibody | anti-GNAT3 antibody

GNAT3 Antibody - middle region

Gene Names
GNAT3; GDCA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNAT3; Polyclonal Antibody; GNAT3 Antibody - middle region; anti-GNAT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKF
Sequence Length
354
Applicable Applications for anti-GNAT3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: GNAT3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GNAT3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNAT3Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNAT3Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GNAT3 antibody
Sweet, bitter, and umami tastes are transmitted from taste receptors by a specific guanine nucleotide binding protein. The protein encoded by this gene is the alpha subunit of this heterotrimeric G protein, which is found not only in the oral epithelium but also in gut tissues. Variations in this gene have been linked to metabolic syndrome.
Product Categories/Family for anti-GNAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(t) subunit alpha-3
NCBI Official Synonym Full Names
G protein subunit alpha transducin 3
NCBI Official Symbol
GNAT3
NCBI Official Synonym Symbols
GDCA
NCBI Protein Information
guanine nucleotide-binding protein G(t) subunit alpha-3
UniProt Protein Name
Guanine nucleotide-binding protein G(t) subunit alpha-3
UniProt Gene Name
GNAT3
UniProt Entry Name
GNAT3_HUMAN

NCBI Description

Sweet, bitter, and umami tastes are transmitted from taste receptors by a specific guanine nucleotide binding protein. The protein encoded by this gene is the alpha subunit of this heterotrimeric G protein, which is found not only in the oral epithelium but also in gut tissues. Variations in this gene have been linked to metabolic syndrome. [provided by RefSeq, Dec 2015]

Uniprot Description

G-alpha t3: Guanine nucleotide-binding protein (G protein) alpha subunit playing a prominent role in bitter and sweet taste transduction as well as in umami (monosodium glutamate, monopotassium glutamate, and inosine monophosphate) taste transduction. Transduction by this alpha subunit involves coupling of specific cell-surface receptors with a cGMP-phosphodiesterase; Activation of phosphodiesterase lowers intracellular levels of cAMP and cGMP which may open a cyclic nucleotide-suppressible cation channel leading to influx of calcium, ultimately leading to release of neurotransmitter. Indeed, denatonium and strychnine induce transient reduction in cAMP and cGMP in taste tissue, whereas this decrease is inhibited by GNAT3 antibody. Gustducin heterotrimer transduces response to bitter and sweet compounds via regulation of phosphodiesterase for alpha subunit, as well as via activation of phospholipase C for beta and gamma subunits, with ultimate increase inositol trisphosphate and increase of intracellular Calcium. GNAT3 can functionally couple to taste receptors to transmit intracellular signal: receptor heterodimer TAS1R2/TAS1R3 senses sweetness and TAS1R1/TAS1R3 transduces umami taste, whereas the T2R family GPCRs act as bitter sensors. Functions also as lumenal sugar sensors in the gut to control the expression of the Na+-glucose transporter SGLT1 in response to dietaty sugar, as well as the secretion of Glucagon-like peptide- 1, GLP-1 and glucose-dependent insulinotropic polypeptide, GIP. Thus, may modulate the gut capacity to absorb sugars, with implications in malabsorption syndromes and diet-related disorders including diabetes and obesity. Belongs to the G-alpha family. G(i/o/t/z) subfamily.

Protein type: G protein, heterotrimeric; G protein; G protein, heterotrimeric alpha G((i/o/t/z))

Chromosomal Location of Human Ortholog: 7q21.11

Cellular Component: protein complex; photoreceptor inner segment; photoreceptor outer segment; apical plasma membrane; plasma membrane; acrosome; heterotrimeric G-protein complex; axoneme

Molecular Function: GTPase activity; G-protein-coupled receptor binding; GTP binding; metal ion binding; G-protein beta/gamma-subunit binding; G-protein coupled photoreceptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; response to nicotine; platelet activation; synaptic transmission; sensory perception of umami taste; sensory perception of sweet taste; metabolic process; detection of chemical stimulus involved in sensory perception of bitter taste; G-protein signaling, adenylate cyclase inhibiting pathway; blood coagulation; detection of visible light

Research Articles on GNAT3

Similar Products

Product Notes

The GNAT3 gnat3 (Catalog #AAA3220723) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAT3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNAT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAT3 gnat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ICFPEYTGPN TFEDAGNYIK NQFLDLNLKK EDKEIYSHMT CATDTQNVKF. It is sometimes possible for the material contained within the vial of "GNAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.