Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RNASEH2BSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RNASEH2B Polyclonal Antibody | anti-RNASEH2B antibody

RNASEH2B Antibody - middle region

Gene Names
RNASEH2B; AGS2; DLEU8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RNASEH2B; Polyclonal Antibody; RNASEH2B Antibody - middle region; anti-RNASEH2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQS
Sequence Length
410
Applicable Applications for anti-RNASEH2B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RNASEH2BSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RNASEH2BSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RNASEH2B antibody
RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2).
Product Categories/Family for anti-RNASEH2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
ribonuclease H2 subunit B isoform 2
NCBI Official Synonym Full Names
ribonuclease H2 subunit B
NCBI Official Symbol
RNASEH2B
NCBI Official Synonym Symbols
AGS2; DLEU8
NCBI Protein Information
ribonuclease H2 subunit B
UniProt Protein Name
Ribonuclease H2 subunit B
Protein Family
UniProt Gene Name
RNASEH2B
UniProt Synonym Gene Names
DLEU8; RNase H2 subunit B; AGS2
UniProt Entry Name
RNH2B_HUMAN

NCBI Description

RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). [provided by RefSeq, Nov 2008]

Uniprot Description

RNASEH2B: Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging- strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes. Defects in RNASEH2B are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). A form of Aicardi-Goutieres syndrome, a genetically heterogeneous disease characterized by cerebral atrophy, leukoencephalopathy, intracranial calcifications, chronic cerebrospinal fluid (CSF) lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infection. Clinical features as thrombocytopenia, hepatosplenomegaly and elevated hepatic transaminases along with intermittent fever may erroneously suggest an infective process. Severe neurological dysfunctions manifest in infancy as progressive microcephaly, spasticity, dystonic posturing and profound psychomotor retardation. Death often occurs in early childhood. Belongs to the RNase H2 subunit B family.

Protein type: DNA replication; RNA processing

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: nucleoplasm; nucleus

Molecular Function: ribonuclease H activity

Biological Process: positive regulation of fibroblast proliferation; ribonucleotide metabolic process; in utero embryonic development; RNA catabolic process; regulation of G2/M transition of mitotic cell cycle

Disease: Aicardi-goutieres Syndrome 2

Research Articles on RNASEH2B

Similar Products

Product Notes

The RNASEH2B rnaseh2b (Catalog #AAA3220717) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASEH2B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNASEH2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNASEH2B rnaseh2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEEKGNPEID NKKYYKYSKE KTLKWLEKKV NQTVAALKTN NVNVSSRVQS. It is sometimes possible for the material contained within the vial of "RNASEH2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.