Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KLHL9Sample Tissue: Human PANC1Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human KLHL9 Polyclonal Antibody | anti-KLHL9 antibody

KLHL9 Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KLHL9; Polyclonal Antibody; KLHL9 Antibody - C-terminal region; anti-KLHL9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLS
Sequence Length
617
Applicable Applications for anti-KLHL9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KLHL9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KLHL9Sample Tissue: Human PANC1Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KLHL9Sample Tissue: Human PANC1Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-KLHL9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69 kDa
NCBI Official Full Name
kelch-like protein 9
NCBI Official Synonym Full Names
kelch like family member 9
NCBI Official Symbol
KLHL9
NCBI Protein Information
kelch-like protein 9
UniProt Protein Name
Kelch-like protein 9
Protein Family
UniProt Gene Name
KLHL9
UniProt Synonym Gene Names
KIAA1354
UniProt Entry Name
KLHL9_HUMAN

NCBI Description

This gene encodes a protein that belongs to the kelch repeat-containing family, and contains an N-terminal BTB/POZ domain, a BACK domain and six C-terminal kelch repeats. The encoded protein is a component of a complex with cullin 3-based E3 ligase, which plays a role in mitosis. This protein complex is a cell cycle regulator, and functions in the organization and integrity of the spindle midzone in anaphase and the completion of cytokinesis. The complex is required for the removal of the chromosomal passenger protein aurora B from mitotic chromosomes. [provided by RefSeq, Jul 2016]

Uniprot Description

KLHL9: Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis.

Protein type: Ubiquitin conjugating system; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: midbody

Molecular Function: ubiquitin-protein ligase activity

Biological Process: mitosis; cytokinesis; protein ubiquitination

Research Articles on KLHL9

Similar Products

Product Notes

The KLHL9 klhl9 (Catalog #AAA3220682) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL9 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLHL9 klhl9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIVQKYDPEK DEWHKVFDLP ESLGGIRACT LTVFPPEENP GSPSRESPLS. It is sometimes possible for the material contained within the vial of "KLHL9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.