Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: OTUD4Sample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human OTUD4 Polyclonal Antibody | anti-OTUD4 antibody

OTUD4 Antibody - C-terminal region

Gene Names
OTUD4; HIN1; DUBA6; HSHIN1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
OTUD4; Polyclonal Antibody; OTUD4 Antibody - C-terminal region; anti-OTUD4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DWGYSGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDRRRSG
Sequence Length
1049
Applicable Applications for anti-OTUD4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human OTUD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OTUD4Sample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OTUD4Sample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OTUD4 antibody
Alternatively spliced transcript variants have been found for this gene. The smaller protein isoform encoded by the shorter transcript variant is found only in HIV-1 infected cells.
Product Categories/Family for anti-OTUD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115 kDa
NCBI Official Full Name
OTU domain-containing protein 4 isoform 3
NCBI Official Synonym Full Names
OTU deubiquitinase 4
NCBI Official Symbol
OTUD4
NCBI Official Synonym Symbols
HIN1; DUBA6; HSHIN1
NCBI Protein Information
OTU domain-containing protein 4
UniProt Protein Name
OTU domain-containing protein 4
UniProt Gene Name
OTUD4
UniProt Synonym Gene Names
HIN1; KIAA1046
UniProt Entry Name
OTUD4_HUMAN

NCBI Description

Alternatively spliced transcript variants have been found for this gene. The smaller protein isoform encoded by the shorter transcript variant is found only in HIV-1 infected cells. [provided by RefSeq, Jul 2010]

Uniprot Description

OTUD4: Alternatively spliced transcript variants have been found for this gene. The smaller protein isoform encoded by the shorter transcript variant is found only in HIV-1 infected cells. [provided by RefSeq, Jul 2010]

Protein type: Hydrolase; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 4q31.21

Molecular Function: ubiquitin-specific protease activity

Biological Process: proteolysis

Research Articles on OTUD4

Similar Products

Product Notes

The OTUD4 otud4 (Catalog #AAA3220668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTUD4 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OTUD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTUD4 otud4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DWGYSGRGGY QHVRSEESWK GQPSRSRDEG YQYHRNVRGR PFRGDRRRSG. It is sometimes possible for the material contained within the vial of "OTUD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.