Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHCHD2Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CHCHD2 Polyclonal Antibody | anti-CHCHD2 antibody

CHCHD2 Antibody - middle region

Gene Names
CHCHD2; MNRR1; NS2TP; MIX17B; PARK22; C7orf17
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHCHD2; Polyclonal Antibody; CHCHD2 Antibody - middle region; anti-CHCHD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLY
Sequence Length
151
Applicable Applications for anti-CHCHD2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHCHD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHCHD2Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHCHD2Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHCHD2 antibody
Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen).
Product Categories/Family for anti-CHCHD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
coiled-coil-helix-coiled-coil-helix domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
coiled-coil-helix-coiled-coil-helix domain containing 2
NCBI Official Symbol
CHCHD2
NCBI Official Synonym Symbols
MNRR1; NS2TP; MIX17B; PARK22; C7orf17
NCBI Protein Information
coiled-coil-helix-coiled-coil-helix domain-containing protein 2
UniProt Protein Name
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial
UniProt Gene Name
CHCHD2
UniProt Synonym Gene Names
C7orf17; NS2TP
UniProt Entry Name
CHCH2_HUMAN

NCBI Description

The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

CHCHD2: Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen) (PubMed:23303788). {ECO:0000269|PubMed:23303788}. Up-regulated by hypoxia (4% oxygen) (at protein level). {ECO:0000269|PubMed:23303788}. Interacts with RBPJ. {ECO:0000269|PubMed:23303788}

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7p11.2

Cellular Component: mitochondrion

Research Articles on CHCHD2

Similar Products

Product Notes

The CHCHD2 chchd2 (Catalog #AAA3220658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHCHD2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHCHD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHCHD2 chchd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVGSAVGHTL GHAITGGFSG GSNAEPARPD ITYQEPQGTQ PAQQQQPCLY. It is sometimes possible for the material contained within the vial of "CHCHD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.