Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: GNMTSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit anti-Human GNMT Polyclonal Antibody | anti-GNMT antibody

GNMT Antibody - middle region

Gene Names
GNMT; HEL-S-182mP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNMT; Polyclonal Antibody; GNMT Antibody - middle region; anti-GNMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQ
Sequence Length
345
Applicable Applications for anti-GNMT antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: GNMTSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GNMTSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNMTSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNMTSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GNMT antibody
The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. The encoded protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia).
Product Categories/Family for anti-GNMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
glycine N-methyltransferase isoform 1
NCBI Official Synonym Full Names
glycine N-methyltransferase
NCBI Official Symbol
GNMT
NCBI Official Synonym Symbols
HEL-S-182mP
NCBI Protein Information
glycine N-methyltransferase
UniProt Protein Name
Glycine N-methyltransferase
UniProt Gene Name
GNMT
UniProt Entry Name
GNMT_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016]

Uniprot Description

GNMT: Catalyzes the methylation of glycine by using S- adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). Possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine. Defects in GNMT are the cause of glycine N- methyltransferase deficiency (GNMT deficiency); also known as hypermethioninemia. The only clinical abnormalities in patients with this deficiency are mild hepatomegaly and chronic elevation of serum transaminases. Belongs to the class I-like SAM-binding methyltransferase superfamily. Glycine N-methyltransferase family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Methyltransferase; EC 2.1.1.20

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: cytoplasm

Molecular Function: protein binding; glycine N-methyltransferase activity; glycine binding; folic acid binding

Biological Process: methylation; glycogen metabolic process; S-adenosylmethionine metabolic process; protein modification process; regulation of gluconeogenesis; methionine metabolic process; one-carbon compound metabolic process; protein homotetramerization

Disease: Glycine N-methyltransferase Deficiency

Research Articles on GNMT

Similar Products

Product Notes

The GNMT gnmt (Catalog #AAA3220635) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNMT Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNMT gnmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HRNYDHILST GCAPPGKNIY YKSDLTKDVT TSVLIVNNKA HMVTLDYTVQ. It is sometimes possible for the material contained within the vial of "GNMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.