Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: YME1L1Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human YME1L1 Polyclonal Antibody | anti-YME1L1 antibody

YME1L1 Antibody - middle region

Gene Names
YME1L1; FTSH; MEG4; PAMP; OPA11; YME1L
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
YME1L1; Polyclonal Antibody; YME1L1 Antibody - middle region; anti-YME1L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: MGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTL
Sequence Length
773
Applicable Applications for anti-YME1L1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human YME1L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: YME1L1Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: YME1L1Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-YME1L1 antibody
The protein encoded by this gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-YME1L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85 kDa
NCBI Official Full Name
ATP-dependent zinc metalloprotease YME1L1 isoform 4
NCBI Official Synonym Full Names
YME1 like 1 ATPase
NCBI Official Symbol
YME1L1
NCBI Official Synonym Symbols
FTSH; MEG4; PAMP; OPA11; YME1L
NCBI Protein Information
ATP-dependent zinc metalloprotease YME1L1
UniProt Protein Name
ATP-dependent zinc metalloprotease YME1L1
UniProt Gene Name
YME1L1
UniProt Synonym Gene Names
FTSH1; YME1L; PAMP
UniProt Entry Name
YMEL1_HUMAN

NCBI Description

The protein encoded by this gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

YME1L1: Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. Requires to control the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4 and ND1). Seems to act in the processing of OPA1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Protease; EC 3.4.24.-

Chromosomal Location of Human Ortholog: 10p14

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion; nucleoplasm

Molecular Function: ATP binding; ATP-dependent peptidase activity; metal ion binding; metalloendopeptidase activity; metallopeptidase activity

Biological Process: cell proliferation; misfolded or incompletely synthesized protein catabolic process; mitochondrion organization and biogenesis

Research Articles on YME1L1

Similar Products

Product Notes

The YME1L1 yme1l1 (Catalog #AAA3220545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YME1L1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's YME1L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the YME1L1 yme1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGPERRSVEI DNKNKTITAY HESGHAIIAY YTKDAMPINK ATIMPRGPTL. It is sometimes possible for the material contained within the vial of "YME1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.