Western Blot (WB)
(Host: RabbitTarget Name: DCLRE1ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human DCLRE1A Polyclonal Antibody | anti-DCLRE1A antibody
DCLRE1A Antibody - N-terminal region
Gene Names
DCLRE1A; PSO2; SNM1; SNM1A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DCLRE1A; Polyclonal Antibody; DCLRE1A Antibody - N-terminal region; anti-DCLRE1A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNRKR
Sequence Length
167
Applicable Applications for anti-DCLRE1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DCLRE1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DCLRE1ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DCLRE1ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DCLRE1A antibody
This gene encodes a conserved protein that is involved in the repair of DNA interstrand cross-links. DNA cross-links suppress transcription, replication, and DNA segregation. The encoded protein is a regulator of the mitotic cell cycle checkpoint. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-DCLRE1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116 kDa
NCBI Official Full Name
DNA cross-link repair 1A protein
NCBI Official Synonym Full Names
DNA cross-link repair 1A
NCBI Official Symbol
DCLRE1A
NCBI Official Synonym Symbols
PSO2; SNM1; SNM1A
NCBI Protein Information
DNA cross-link repair 1A protein
UniProt Protein Name
DNA cross-link repair 1A protein
Protein Family
UniProt Gene Name
DCLRE1A
UniProt Synonym Gene Names
KIAA0086; SNM1; SNM1A; hSNM1; hSNM1A
UniProt Entry Name
DCR1A_HUMAN
NCBI Description
This gene encodes a conserved protein that is involved in the repair of DNA interstrand cross-links. DNA cross-links suppress transcription, replication, and DNA segregation. The encoded protein is a regulator of the mitotic cell cycle checkpoint. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Uniprot Description
DCLRE1A: May be required for DNA interstrand cross-link repair. Also required for checkpoint mediated cell cycle arrest in early prophase in response to mitotic spindle poisons. Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family.
Chromosomal Location of Human Ortholog: 10q25.1
Cellular Component: nucleolus; nucleus
Biological Process: mitosis; cell division; nucleotide-excision repair
Research Articles on DCLRE1A
Similar Products
Product Notes
The DCLRE1A dclre1a (Catalog #AAA3220514) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCLRE1A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCLRE1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCLRE1A dclre1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DISEEDIWEY KSKRKPKRVD PNNGSKNILK SVEKATDGKY QSKRSRNRKR. It is sometimes possible for the material contained within the vial of "DCLRE1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
