Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SAFB2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SAFB2 Polyclonal Antibody | anti-SAFB2 antibody

SAFB2 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SAFB2; Polyclonal Antibody; SAFB2 Antibody - middle region; anti-SAFB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGW
Sequence Length
167
Applicable Applications for anti-SAFB2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAFB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SAFB2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SAFB2Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-SAFB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
scaffold attachment factor B2
NCBI Official Synonym Full Names
scaffold attachment factor B2
NCBI Official Symbol
SAFB2
NCBI Protein Information
scaffold attachment factor B2
UniProt Protein Name
Scaffold attachment factor B2
UniProt Gene Name
SAFB2
UniProt Synonym Gene Names
KIAA0138; SAF-B2
UniProt Entry Name
SAFB2_HUMAN

NCBI Description

The protein encoded by this gene, along with its paralog (scaffold attachment factor B1), is a repressor of estrogen receptor alpha. The encoded protein binds scaffold/matrix attachment region (S/MAR) DNA and is involved in cell cycle regulation, apoptosis, differentiation, the stress response, and regulation of immune genes. [provided by RefSeq, May 2016]

Uniprot Description

SAFB2: Binds to scaffold/matrix attachment region (S/MAR) DNA. Can function as an estrogen receptor corepressor and can also inhibit cell proliferation.

Protein type: Nuclear receptor co-regulator; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm

Molecular Function: identical protein binding; protein binding; DNA binding; nucleotide binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on SAFB2

Similar Products

Product Notes

The SAFB2 safb2 (Catalog #AAA3220499) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAFB2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAFB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAFB2 safb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGQYQDHAID RREGSRPMMG DHRDGQHYGD DRHGHGGPPE RHGRDSRDGW. It is sometimes possible for the material contained within the vial of "SAFB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.