Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TCN2Sample Tissue: leiomyosarcoma lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TCN2 Polyclonal Antibody | anti-TCN2 antibody

TCN2 Antibody - middle region

Gene Names
TCN2; II; TC; TC2; TC-2; TCII; TC II; D22S676; D22S750
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TCN2; Polyclonal Antibody; TCN2 Antibody - middle region; anti-TCN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: GHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKR
Sequence Length
427
Applicable Applications for anti-TCN2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TCN2Sample Tissue: leiomyosarcoma lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TCN2Sample Tissue: leiomyosarcoma lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TCN2 antibody
This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This plasma protein binds cobalamin and mediates the transport of cobalamin into cells. This protein and other mammalian cobalamin-binding proteins, such as transcobalamin I and gastric intrisic factor, may have evolved by duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TCN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
transcobalamin-2 isoform 1
NCBI Official Synonym Full Names
transcobalamin 2
NCBI Official Symbol
TCN2
NCBI Official Synonym Symbols
II; TC; TC2; TC-2; TCII; TC II; D22S676; D22S750
NCBI Protein Information
transcobalamin-2
UniProt Protein Name
Transcobalamin-2
Protein Family
UniProt Gene Name
TCN2
UniProt Synonym Gene Names
TC2; TC-2; TC II; TCII
UniProt Entry Name
TCO2_HUMAN

NCBI Description

This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This plasma protein binds cobalamin and mediates the transport of cobalamin into cells. This protein and other mammalian cobalamin-binding proteins, such as transcobalamin I and gastric intrisic factor, may have evolved by duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

TCN2: Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells. Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency). This results in various forms of anemia. Belongs to the eukaryotic cobalamin transport proteins family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: extracellular space; lysosomal lumen; extracellular region; endosome

Molecular Function: metal ion binding; cobalamin binding

Biological Process: vitamin metabolic process; cobalamin metabolic process; cobalamin transport; cobalt ion transport; water-soluble vitamin metabolic process

Disease: Transcobalamin Ii Deficiency

Research Articles on TCN2

Similar Products

Product Notes

The TCN2 tcn2 (Catalog #AAA3220428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCN2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCN2 tcn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GHKGDRLVSQ LKWFLEDEKR AIGHDHKGHP HTSYYQYGLG ILALCLHQKR. It is sometimes possible for the material contained within the vial of "TCN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.