Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL1AP antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Rabbit anti-Human IL1RAP Polyclonal Antibody | anti-IL1RAP antibody

IL1RAP Antibody - C-terminal region

Gene Names
IL1RAP; IL1R3; C3orf13; IL-1RAcP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IL1RAP; Polyclonal Antibody; IL1RAP Antibody - C-terminal region; anti-IL1RAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQG
Sequence Length
570
Applicable Applications for anti-IL1RAP antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-IL1RAP antibody is: synthetic peptide directed towards the C-terminal region of Human IL1AP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL1AP antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Western Blot (WB) (WB Suggested Anti-IL1AP antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)
Related Product Information for anti-IL1RAP antibody
This is a rabbit polyclonal antibody against IL1AP. It was validated on Western Blot

Target Description: Interleukin 1 induces synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress, by forming a complex at the cell membrane with an interleukin 1 receptor and an accessory protein. This gene encodes the interleukin 1 receptor accessory protein. The protein is a necessary part of the interleukin 1 receptor complex which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in two transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress.
Product Categories/Family for anti-IL1RAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62 kDa
NCBI Official Full Name
interleukin-1 receptor accessory protein isoform 2
NCBI Official Synonym Full Names
interleukin 1 receptor accessory protein
NCBI Official Symbol
IL1RAP
NCBI Official Synonym Symbols
IL1R3; C3orf13; IL-1RAcP
NCBI Protein Information
interleukin-1 receptor accessory protein
UniProt Protein Name
Interleukin-1 receptor accessory protein
UniProt Gene Name
IL1RAP
UniProt Synonym Gene Names
C3orf13; IL1R3; IL-1 receptor accessory protein; IL-1RAcP; IL-1R-3; IL-1R3
UniProt Entry Name
IL1AP_HUMAN

NCBI Description

This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. [provided by RefSeq, Jul 2018]

Uniprot Description

IL1RAP: Coreceptor with IL1R1. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Belongs to the interleukin-1 receptor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: membrane; integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: signal transducer activity; interleukin-1 receptor activity

Biological Process: interleukin-2 biosynthetic process; cytokine and chemokine mediated signaling pathway; innate immune response; immune response; protein complex assembly; inflammatory response

Research Articles on IL1RAP

Similar Products

Product Notes

The IL1RAP il1rap (Catalog #AAA3220304) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL1RAP Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1RAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL1RAP il1rap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KELKRAKTVL TVIKWKGEKS KYPQGRFWKQ LQVAMPVKKS PRRSSSDEQG. It is sometimes possible for the material contained within the vial of "IL1RAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.