Western Blot (WB)
(WB Suggested Anti-3BHS2 antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)
Rabbit anti-Human HSD3B2 Polyclonal Antibody | anti-HSD3B2 antibody
HSD3B2 Antibody - middle region
Gene Names
HSD3B2; HSDB; HSD3B; SDR11E2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HSD3B2; Polyclonal Antibody; HSD3B2 Antibody - middle region; anti-HSD3B2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIY
Sequence Length
372
Applicable Applications for anti-HSD3B2 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-HSD3B2 antibody is: synthetic peptide directed towards the middle region of Human 3BHS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-3BHS2 antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)
Western Blot (WB)
(WB Suggested Anti-3BHS2 antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)
Related Product Information for anti-HSD3B2 antibody
This is a rabbit polyclonal antibody against 3BHS2. It was validated on Western Blot
Target Description: The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
Target Description: The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-HSD3B2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
NCBI Official Symbol
HSD3B2
NCBI Official Synonym Symbols
HSDB; HSD3B; SDR11E2
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
Protein Family
UniProt Gene Name
HSD3B2
UniProt Synonym Gene Names
HSDB3B; 3-beta-HSD II
UniProt Entry Name
3BHS2_HUMAN
NCBI Description
The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]
Research Articles on HSD3B2
Similar Products
Product Notes
The HSD3B2 hsd3b2 (Catalog #AAA3220298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD3B2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD3B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSD3B2 hsd3b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HEEEPLENTW PTPYPYSKKL AEKAVLAANG WNLKNGDTLY TCALRPTYIY. It is sometimes possible for the material contained within the vial of "HSD3B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
