Western Blot (WB)
(Host: RabbitTarget Name: STX12Sample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human STX12 Polyclonal Antibody | anti-STX12 antibody
STX12 Antibody - N-terminal region
Gene Names
STX12; STX13; STX14
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STX12; Polyclonal Antibody; STX12 Antibody - N-terminal region; anti-STX12 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQ
Sequence Length
276
Applicable Applications for anti-STX12 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human STX12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: STX12Sample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: STX12Sample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-STX12 antibody
This is a rabbit polyclonal antibody against STX12. It was validated on Western Blot
Target Description: SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion.
Target Description: SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion.
Product Categories/Family for anti-STX12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
syntaxin-12
NCBI Official Synonym Full Names
syntaxin 12
NCBI Official Symbol
STX12
NCBI Official Synonym Symbols
STX13; STX14
NCBI Protein Information
syntaxin-12
UniProt Protein Name
Syntaxin-12
Protein Family
UniProt Gene Name
STX12
UniProt Entry Name
STX12_HUMAN
Uniprot Description
STX12: SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro). Belongs to the syntaxin family.
Protein type: Vesicle; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1p35.3
Cellular Component: Golgi membrane; SNARE complex; integral to membrane; endomembrane system; endosome membrane; phagocytic vesicle; lipid raft
Molecular Function: SNAP receptor activity; SNARE binding; protein binding
Biological Process: vesicle fusion; intracellular protein transport; vesicle docking; protein stabilization; cholesterol efflux
Research Articles on STX12
Similar Products
Product Notes
The STX12 stx12 (Catalog #AAA3220027) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX12 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STX12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STX12 stx12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLDMYRNPGP SGPQLRDFSS IIQTCSGNIQ RISQATAQIK NLMSQLGTKQ. It is sometimes possible for the material contained within the vial of "STX12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
