Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TCOFSample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TCOF1 Polyclonal Antibody | anti-TCOF1 antibody

TCOF1 Antibody - N-terminal region

Gene Names
TCOF1; TCS; MFD1; TCS1; treacle
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TCOF1; Polyclonal Antibody; TCOF1 Antibody - N-terminal region; anti-TCOF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIY
Sequence Length
1411
Applicable Applications for anti-TCOF1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TCOF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TCOFSample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TCOFSample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TCOF1 antibody
This is a rabbit polyclonal antibody against TCOF. It was validated on Western Blot

Target Description: This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TCOF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
155kDa
NCBI Official Full Name
treacle protein isoform b
NCBI Official Synonym Full Names
treacle ribosome biogenesis factor 1
NCBI Official Symbol
TCOF1
NCBI Official Synonym Symbols
TCS; MFD1; TCS1; treacle
NCBI Protein Information
treacle protein
UniProt Protein Name
Treacle protein
Protein Family
UniProt Gene Name
TCOF1
UniProt Entry Name
TCOF_HUMAN

NCBI Description

This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

treacle: May be involved in nucleolar-cytoplasmic transport. May play a fundamental role in early embryonic development, particularly in development of the craniofacial complex. May participate in certain stages of ribosome biogenesis. Defects in TCOF1 are the cause of Treacher Collins syndrome type 1 (TCS1). It is a form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; transporter activity

Biological Process: transport; skeletal development; transcription of nuclear rRNA large RNA polymerase I transcript

Disease: Treacher Collins Syndrome 1

Research Articles on TCOF1

Similar Products

Product Notes

The TCOF1 tcof1 (Catalog #AAA3219939) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCOF1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCOF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCOF1 tcof1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAEARKRREL LPLIYHHLLR AGYVRAAREV KEQSGQKCFL AQPVTLLDIY. It is sometimes possible for the material contained within the vial of "TCOF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.