Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IBP2Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human IGFBP2 Polyclonal Antibody | anti-IGFBP2 antibody

IGFBP2 Antibody - middle region

Gene Names
IGFBP2; IBP2; IGF-BP53
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IGFBP2; Polyclonal Antibody; IGFBP2 Antibody - middle region; anti-IGFBP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENH
Sequence Length
325
Applicable Applications for anti-IGFBP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human IBP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IBP2Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IBP2Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IGFBP2 antibody
This is a rabbit polyclonal antibody against IBP2. It was validated on Western Blot

Target Description: The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
insulin-like growth factor-binding protein 2 isoform a
NCBI Official Synonym Full Names
insulin like growth factor binding protein 2
NCBI Official Symbol
IGFBP2
NCBI Official Synonym Symbols
IBP2; IGF-BP53
NCBI Protein Information
insulin-like growth factor-binding protein 2
UniProt Protein Name
Insulin-like growth factor-binding protein 2
UniProt Gene Name
IGFBP2
UniProt Synonym Gene Names
BP2; IBP2; IBP-2; IGF-binding protein 2; IGFBP-2
UniProt Entry Name
IBP2_HUMAN

NCBI Description

The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

IGFBP2: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Binds IGF2 more than IGF1.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: extracellular space; apical plasma membrane; extracellular region; cytoplasmic vesicle

Molecular Function: protein binding; insulin-like growth factor I binding; insulin-like growth factor II binding

Biological Process: response to drug; response to retinoic acid; regulation of insulin-like growth factor receptor signaling pathway; response to lithium ion; response to glucocorticoid stimulus; female pregnancy; signal transduction; positive regulation of activated T cell proliferation; response to estradiol stimulus; cellular response to hormone stimulus; cellular protein metabolic process; response to mechanical stimulus; regulation of cell growth; response to nutrient; aging

Research Articles on IGFBP2

Similar Products

Product Notes

The IGFBP2 igfbp2 (Catalog #AAA3219750) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGFBP2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IGFBP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IGFBP2 igfbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHPGSELPLQ ALVMGEGTCE KRRDAEYGAS PEQVADNGDD HSEGGLVENH. It is sometimes possible for the material contained within the vial of "IGFBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.