Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VEGFCSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VEGFC Polyclonal Antibody | anti-VEGFC antibody

VEGFC Antibody - N-terminal region

Gene Names
VEGFC; VRP; Flt4-L; LMPH1D; LMPHM4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VEGFC; Polyclonal Antibody; VEGFC Antibody - N-terminal region; anti-VEGFC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTE
Sequence Length
419
Applicable Applications for anti-VEGFC antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VEGFC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VEGFCSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VEGFCSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VEGFC antibody
This is a rabbit polyclonal antibody against VEGFC. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors.
Product Categories/Family for anti-VEGFC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
vascular endothelial growth factor C preproprotein
NCBI Official Synonym Full Names
vascular endothelial growth factor C
NCBI Official Symbol
VEGFC
NCBI Official Synonym Symbols
VRP; Flt4-L; LMPH1D; LMPHM4
NCBI Protein Information
vascular endothelial growth factor C
UniProt Protein Name
Vascular endothelial growth factor C
UniProt Gene Name
VEGFC
UniProt Synonym Gene Names
VEGF-C; Flt4-L; VRP
UniProt Entry Name
VEGFC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors. [provided by RefSeq, Apr 2014]

Uniprot Description

VEGFC: Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Homodimer; non-covalent and antiparallel. Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte. Belongs to the PDGF/VEGF growth factor family.

Protein type: Motility/polarity/chemotaxis; Cell cycle regulation; Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 4q34.3

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: protein binding; growth factor activity; vascular endothelial growth factor receptor 3 binding; chemoattractant activity

Biological Process: response to drug; substrate-bound cell migration; platelet activation; positive regulation of neuroblast proliferation; positive regulation of blood vessel endothelial cell migration; signal transduction; positive regulation of protein amino acid autophosphorylation; induction of positive chemotaxis; negative regulation of cell proliferation; organ morphogenesis; positive regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; morphogenesis of embryonic epithelium; platelet degranulation; positive regulation of protein secretion; positive chemotaxis; positive regulation of cell division; regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of cell proliferation; angiogenesis; negative regulation of blood pressure; vascular endothelial growth factor receptor signaling pathway; positive regulation of cell-matrix adhesion; blood coagulation; positive regulation of epithelial cell proliferation

Disease: Lymphedema, Hereditary, Id

Research Articles on VEGFC

Similar Products

Product Notes

The VEGFC vegfc (Catalog #AAA3219632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VEGFC Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VEGFC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VEGFC vegfc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELMTVLYPEY WKMYKCQLRK GGWQHNREQA NLNSRTEETI KFAAAHYNTE. It is sometimes possible for the material contained within the vial of "VEGFC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.