Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYO1FSample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MYO1F Polyclonal Antibody | anti-MYO1F antibody

MYO1F Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYO1F; Polyclonal Antibody; MYO1F Antibody - C-terminal region; anti-MYO1F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQR
Sequence Length
1098
Applicable Applications for anti-MYO1F antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYO1F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYO1FSample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYO1FSample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYO1F antibody
This is a rabbit polyclonal antibody against MYO1F. It was validated on Western Blot

Target Description: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.
Product Categories/Family for anti-MYO1F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
unconventional myosin-If isoform 1
NCBI Official Synonym Full Names
myosin IF
NCBI Official Symbol
MYO1F
NCBI Protein Information
unconventional myosin-If
UniProt Protein Name
Unconventional myosin-If
Protein Family
UniProt Gene Name
MYO1F
UniProt Entry Name
MYO1F_HUMAN

NCBI Description

Myosins are molecular motors that use the energy from ATP hydrolysis to generate force on actin filaments. The protein encoded by this gene is an unconventional myosin that may be involved in the intracellular movement of membrane-enclosed compartments. There is evidence to suggest that mutations in this gene can result in hearing loss. [provided by RefSeq, Jan 2017]

Research Articles on MYO1F

Similar Products

Product Notes

The MYO1F myo1f (Catalog #AAA3219266) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYO1F Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYO1F can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYO1F myo1f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CIKPNETKRP RDWEENRVKH QVEYLGLKEN IRVRRAGFAY RRQFAKFLQR. It is sometimes possible for the material contained within the vial of "MYO1F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.