Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAPK12Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Rabbit MAPK12 Polyclonal Antibody | anti-MAPK12 antibody

MAPK12 Antibody - C-terminal region

Gene Names
MAPK12; ERK3; ERK6; ERK-6; SAPK3; PRKM12; SAPK-3; MAPK 12; P38GAMMA
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAPK12; Polyclonal Antibody; MAPK12 Antibody - C-terminal region; anti-MAPK12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSK
Sequence Length
367
Applicable Applications for anti-MAPK12 antibody
Western Blot (WB)
Homology
Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAPK12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAPK12Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAPK12Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAPK12 antibody
This is a rabbit polyclonal antibody against MAPK12. It was validated on Western Blot

Target Description: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
mitogen-activated protein kinase 12 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 12
NCBI Official Symbol
MAPK12
NCBI Official Synonym Symbols
ERK3; ERK6; ERK-6; SAPK3; PRKM12; SAPK-3; MAPK 12; P38GAMMA
NCBI Protein Information
mitogen-activated protein kinase 12
UniProt Protein Name
Mitogen-activated protein kinase 12
UniProt Gene Name
MAPK12
UniProt Synonym Gene Names
ERK6; SAPK3; MAP kinase 12; MAPK 12; ERK-6
UniProt Entry Name
MK12_HUMAN

NCBI Description

Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq, Jul 2008]

Uniprot Description

P38G: a proline-directed ser/thr MAP kinase, and one of four p38 kinases that play important roles in cellular responses to inflammatory cytokines, DNA damage, oxidative stress, and some GPCRs. Directly activate transcription factors and of other downstream kinases including MSK1, MSK2, eEF2K, MK2, and PRAK. MSK1 and -2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli. MK2 and -3 control gene expression mostly at the post-transcriptional level. eEF2K is important for the elongation of mRNA during translation. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17, which then cleaves the ectodomain of TGF-alpha family ligands, a process leading to the activation of EGFR signaling and cell proliferation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, CHOPO, p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. Interacts directly with HDAC3 interacts directly and selectively to repress ATF2 transcriptional activity, and regulate TNF gene expression in LPS-stimulated cells. Plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting that it may inhibit cell proliferation while promoting differentiation. Regulates UV-induced checkpoint signaling and repair of UV-induced DNA damage and G2 arrest after gamma-radiation exposure. Involved in the regulation of GLUT1 expression and basal glucose uptake in L6 myotubes; and negatively regulates GLUT4 expression and contraction-mediated glucose uptake in adult skeletal muscle. C- Jun phosphorylation is stimulated by p38-alpha and inhibited by p38-gamma, leading to a distinct AP-1 regulation. Required for the normal kinetochore localization of PLK1, prevents chromosomal instability and supports mitotic cell viability. Positively regulates the expansion of transient amplifying myogenic precursor cells during muscle growth and regeneration. Its expression is down-regulation by p38-alpha activation. Highly expressed in skeletal muscle and heart.

Protein type: EC 2.7.11.24; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CMGC; Kinase, protein; CMGC group; MAPK family; MAPK/p38 subfamily; p38 subfamily

Chromosomal Location of Human Ortholog: 22q13.33

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; cytosol

Molecular Function: MAP kinase activity; protein serine/threonine kinase activity; protein binding; magnesium ion binding; ATP binding

Biological Process: mitochondrion organization and biogenesis; muscle development; nerve growth factor receptor signaling pathway; DNA damage induced protein phosphorylation; transcription, DNA-dependent; organelle organization and biogenesis; MAPKKK cascade; signal transduction; myoblast differentiation; muscle cell differentiation; peptidyl-serine phosphorylation; regulation of transcription, DNA-dependent; Ras protein signal transduction; positive regulation of muscle cell differentiation; vascular endothelial growth factor receptor signaling pathway; cell cycle arrest

Research Articles on MAPK12

Similar Products

Product Notes

The MAPK12 mapk12 (Catalog #AAA3219243) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK12 Antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK12 mapk12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHDTEDEPQV QKYDDSFDDV DRTLDEWKRV TYKEVLSFKP PRQLGARVSK. It is sometimes possible for the material contained within the vial of "MAPK12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.