Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAP3K7Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MAP3K7 Polyclonal Antibody | anti-MAP3K7 antibody

MAP3K7 Antibody - C-terminal region

Gene Names
MAP3K7; CSCF; FMD2; TAK1; MEKK7; TGF1a
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAP3K7; Polyclonal Antibody; MAP3K7 Antibody - C-terminal region; anti-MAP3K7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDN
Sequence Length
579
Applicable Applications for anti-MAP3K7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAP3K7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAP3K7Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAP3K7Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MAP3K7 antibody
This is a rabbit polyclonal antibody against MAP3K7. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-MAP3K7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 7 isoform A
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 7
NCBI Official Symbol
MAP3K7
NCBI Official Synonym Symbols
CSCF; FMD2; TAK1; MEKK7; TGF1a
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 7
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 7
UniProt Gene Name
MAP3K7
UniProt Synonym Gene Names
TAK1; TGF-beta-activated kinase 1
UniProt Entry Name
M3K7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TAK1: a protein kinase of the MLK family. Mediates signal transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. Also activates MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced isoforms have been reported. Three splice variant isoforms have been described.

Protein type: EC 2.7.11.25; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; TKL group; MLK family; TAK1 subfamily

Chromosomal Location of Human Ortholog: 6q15

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; endosome membrane; IkappaB kinase complex; cytosol; nucleus

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase activity; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: positive regulation of JNK activity; I-kappaB kinase/NF-kappaB cascade; activation of MAPKK activity; activation of MAPK activity; apoptosis; stress-activated MAPK cascade; positive regulation of T cell cytokine production; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; transforming growth factor beta receptor signaling pathway; JNK cascade; angiogenesis; toll-like receptor 4 signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; activation of NF-kappaB-inducing kinase; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interleukin-2 production; toll-like receptor signaling pathway; innate immune response; positive regulation of T cell activation; toll-like receptor 9 signaling pathway; I-kappaB phosphorylation; neural tube formation

Research Articles on MAP3K7

Similar Products

Product Notes

The MAP3K7 map3k7 (Catalog #AAA3219218) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP3K7 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAP3K7 map3k7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTGTEPGQVS SRSSSPSVRM ITTSGPTSEK PTRSHPWTPD DSTDTNGSDN. It is sometimes possible for the material contained within the vial of "MAP3K7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.