Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TCTEX1D2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Rabbit TCTEX1D2 Polyclonal Antibody | anti-TCTEX1D2 antibody

TCTEX1D2 Antibody - C-terminal region

Gene Names
TCTEX1D2; SRTD17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCTEX1D2; Polyclonal Antibody; TCTEX1D2 Antibody - C-terminal region; anti-TCTEX1D2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEG
Sequence Length
106
Applicable Applications for anti-TCTEX1D2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%; Yeast: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TCTEX1D2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TCTEX1D2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TCTEX1D2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-TCTEX1D2 antibody
This is a rabbit polyclonal antibody against TCTEX1D2. It was validated on Western Blot
Product Categories/Family for anti-TCTEX1D2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
tctex1 domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
Tctex1 domain containing 2
NCBI Official Symbol
TCTEX1D2
NCBI Official Synonym Symbols
SRTD17
NCBI Protein Information
tctex1 domain-containing protein 2
UniProt Protein Name
Tctex1 domain-containing protein 2
UniProt Gene Name
TCTEX1D2
UniProt Entry Name
TC1D2_HUMAN

NCBI Description

Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains. This gene encodes a subunit of the human cytoplasmic dynein-2 complex. Mutations in this gene are associated with short-rib thoracic dysplasia 17 with or without polydactyly. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017]

Uniprot Description

TCTEX1D2: Belongs to the dynein light chain Tctex-type family.

Chromosomal Location of Human Ortholog: 3q29

Molecular Function: protein binding

Research Articles on TCTEX1D2

Similar Products

Product Notes

The TCTEX1D2 tctex1d2 (Catalog #AAA3218962) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCTEX1D2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TCTEX1D2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCTEX1D2 tctex1d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELANAEYSPE EMPQLTKHLS ENIKDKLKEM GFDRYKMVVQ VVIGEQRGEG. It is sometimes possible for the material contained within the vial of "TCTEX1D2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.