Western Blot (WB)
(Host: RabbitTarget Name: Gpatch2Sample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Rabbit GPATCH2 Polyclonal Antibody | anti-GPATCH2 antibody
GPATCH2 Antibody - N-terminal region
Gene Names
GPATCH2; Pfa1; CT110; GPATC2; PPP1R30
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPATCH2; Polyclonal Antibody; GPATCH2 Antibody - N-terminal region; anti-GPATCH2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV
Sequence Length
400
Applicable Applications for anti-GPATCH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of mouse GPATCH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Gpatch2Sample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Gpatch2Sample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GPATCH2 antibody
This is a rabbit polyclonal antibody against Gpatch2. It was validated on Western Blot
Product Categories/Family for anti-GPATCH2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
G patch domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
G-patch domain containing 2
NCBI Official Symbol
GPATCH2
NCBI Official Synonym Symbols
Pfa1; CT110; GPATC2; PPP1R30
NCBI Protein Information
G patch domain-containing protein 2
UniProt Protein Name
G patch domain-containing protein 2
Protein Family
UniProt Gene Name
GPATCH2
UniProt Synonym Gene Names
GPATC2
UniProt Entry Name
GPTC2_HUMAN
NCBI Description
The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]
Uniprot Description
Sequence similarities: Contains 1 G-patch domain.
Research Articles on GPATCH2
Similar Products
Product Notes
The GPATCH2 gpatch2 (Catalog #AAA3213168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPATCH2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPATCH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPATCH2 gpatch2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSYNVHHPWE TGHCLSEGSD SSLEEPSKDY REKHSNNKKD RSDSDDQMLV. It is sometimes possible for the material contained within the vial of "GPATCH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
