Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RBMY1A1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human RBMY1A1 Polyclonal Antibody | anti-RBMY1A1 antibody

RBMY1A1 Antibody - C-terminal region

Gene Names
RBMY1A1; RBM; RBM1; RBM2; RBMY; YRRM1; YRRM2; RBMY1C
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBMY1A1; Polyclonal Antibody; RBMY1A1 Antibody - C-terminal region; anti-RBMY1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHVCRKDQRNPPSLGRVLPDPREACGSSSYVASIVDGGESRSEKGDSSRY
Sequence Length
356
Applicable Applications for anti-RBMY1A1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RBMY1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RBMY1A1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RBMY1A1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-RBMY1A1 antibody
This is a rabbit polyclonal antibody against RBMY1A1. It was validated on Western Blot

Target Description: RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
RNA-binding motif protein, Y chromosome, family 1 member A1 isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein, Y-linked, family 1, member A1
NCBI Official Symbol
RBMY1A1
NCBI Official Synonym Symbols
RBM; RBM1; RBM2; RBMY; YRRM1; YRRM2; RBMY1C
NCBI Protein Information
RNA-binding motif protein, Y chromosome, family 1 member A1
UniProt Protein Name
RNA-binding motif protein, Y chromosome, family 1 member A1
Protein Family
UniProt Gene Name
RBMY1A1
UniProt Synonym Gene Names
RBM1; RBM2; YRRM1; YRRM2; hRBMY
UniProt Entry Name
RBY1A_HUMAN

NCBI Description

This gene encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. This protein is thought to function as a splicing regulator during spermatogenesis. Multiple closely related paralogs of this gene are found in a gene cluster in the AZFb azoospermia factor region of chromosome Y. Most of these related copies are thought to be pseudogenes, though several likely encode functional proteins. [provided by RefSeq, Mar 2016]

Uniprot Description

RBMY1A1: RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs. Interacts with splicing factor proteins SFRS3/SRP20, TRA2B/SFRS10, KHDRBS1/SAM68 and KHDRBS3.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: Yq11.223

Cellular Component: nucleus

Molecular Function: mRNA binding; nucleotide binding; protein binding

Biological Process: mRNA processing; regulation of alternative nuclear mRNA splicing, via spliceosome; RNA splicing

Disease: Spermatogenic Failure, Y-linked, 2

Research Articles on RBMY1A1

Similar Products

Product Notes

The RBMY1A1 rbmy1a1 (Catalog #AAA3218910) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBMY1A1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBMY1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBMY1A1 rbmy1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHVCRKDQRN PPSLGRVLPD PREACGSSSY VASIVDGGES RSEKGDSSRY. It is sometimes possible for the material contained within the vial of "RBMY1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.