Rabbit OR8I2 Polyclonal Antibody | anti-OR8I2 antibody

OR8I2 Antibody - C-terminal region

Cat. Num. AAA3218786

• Gene Names: OR8I2; OR11-170
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: OR8I2; Polyclonal Antibody; OR8I2 Antibody - C-terminal region; anti-OR8I2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: YGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
• Sequence Length: 310

• Applicable Applications for anti-OR8I2 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8I2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OR8I2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-OR8I2 antibody

This is a rabbit polyclonal antibody against OR8I2. It was validated on Western Blot

Target Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Product Categories/Family for anti-OR8I2 antibody

Polyclonal; Neurobiology; Signaling Intermediate; Membrane Protein; Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 51230656
• NCBI GeneID: 120586
• NCBI Accession #: NP_001003750
• NCBI GenBank Nucleotide #: NM_001003750
• UniProt Accession #: Q8N0Y5
• Molecular Weight: 34kDa
• NCBI Official Full Name: olfactory receptor 8I2
• NCBI Official Synonym Full Names: olfactory receptor family 8 subfamily I member 2
• NCBI Official Symbol: OR8I2
• NCBI Official Synonym Symbols: OR11-170
• NCBI Protein Information: olfactory receptor 8I2
• UniProt Protein Name: Olfactory receptor 8I2
• Protein Family: Olfactory receptor
• UniProt Gene Name: OR8I2
• UniProt Entry Name: OR8I2_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]

Uniprot Description

OR8I2: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.1

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; detection of chemical stimulus involved in sensory perception of smell