Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit MINPP1 Polyclonal Antibody | anti-MINPP1 antibody

MINPP1 Antibody - C-terminal region

Gene Names
MINPP1; MIPP; HIPER1; MINPP2
Reactivity
Cow, Dog, Guinea Pig, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MINPP1; Polyclonal Antibody; MINPP1 Antibody - C-terminal region; anti-MINPP1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL
Sequence Length
487
Applicable Applications for anti-MINPP1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MINPP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MINPP1 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellMINPP1 is supported by BioGPS gene expression data to be expressed in MDA-MB435)

Related Product Information for anti-MINPP1 antibody
This is a rabbit polyclonal antibody against MINPP1. It was validated on Western Blot

Target Description: This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.
Product Categories/Family for anti-MINPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
multiple inositol polyphosphate phosphatase 1 isoform 1
NCBI Official Synonym Full Names
multiple inositol-polyphosphate phosphatase 1
NCBI Official Symbol
MINPP1
NCBI Official Synonym Symbols
MIPP; HIPER1; MINPP2
NCBI Protein Information
multiple inositol polyphosphate phosphatase 1
UniProt Protein Name
Multiple inositol polyphosphate phosphatase 1
UniProt Gene Name
MINPP1
UniProt Synonym Gene Names
MIPP; 2,3-BPG phosphatase; Ins(1,3,4,5)P(4) 3-phosphatase
UniProt Entry Name
MINP1_HUMAN

NCBI Description

This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009]

Uniprot Description

MINPP1: Acts as a phosphoinositide 5- and phosphoinositide 6- phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3- phosphoglycerate. May play a role in bone development (endochondral ossification). Defects in MINPP1 may be involved in follicular thyroid tumors development. Belongs to the histidine acid phosphatase family. MINPP1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; EC 3.1.3.80; Carbohydrate Metabolism - inositol phosphate; Motility/polarity/chemotaxis; EC 3.1.3.62; Hydrolase

Chromosomal Location of Human Ortholog: 10q23

Cellular Component: endoplasmic reticulum lumen; endoplasmic reticulum

Molecular Function: acid phosphatase activity; phosphohistidine phosphatase activity

Biological Process: polyphosphate metabolic process; ossification; inositol phosphate metabolic process; dephosphorylation; bone mineralization

Disease: Thyroid Carcinoma, Follicular

Research Articles on MINPP1

Similar Products

Product Notes

The MINPP1 minpp1 (Catalog #AAA3217030) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MINPP1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MINPP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MINPP1 minpp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPYASNLIFV LYHCENAKTP KEQFRVQMLL NEKVLPLAYS QETVSFYEDL. It is sometimes possible for the material contained within the vial of "MINPP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual