Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LAIR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Rabbit anti-Human LAIR1 Polyclonal Antibody | anti-LAIR1 antibody

LAIR1 Antibody - C-terminal region

Gene Names
LAIR1; CD305; LAIR-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LAIR1; Polyclonal Antibody; LAIR1 Antibody - C-terminal region; anti-LAIR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL
Sequence Length
270
Applicable Applications for anti-LAIR1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAIR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LAIR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Western Blot (WB) (WB Suggested Anti-LAIR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Related Product Information for anti-LAIR1 antibody
This is a rabbit polyclonal antibody against LAIR1. It was validated on Western Blot

Target Description: The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including NK cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily.
Product Categories/Family for anti-LAIR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
leukocyte-associated immunoglobulin-like receptor 1 isoform c
NCBI Official Synonym Full Names
leukocyte associated immunoglobulin like receptor 1
NCBI Official Symbol
LAIR1
NCBI Official Synonym Symbols
CD305; LAIR-1
NCBI Protein Information
leukocyte-associated immunoglobulin-like receptor 1
UniProt Protein Name
Leukocyte-associated immunoglobulin-like receptor 1
UniProt Gene Name
LAIR1
UniProt Synonym Gene Names
CD305; LAIR-1; hLAIR1
UniProt Entry Name
LAIR1_HUMAN

NCBI Description

The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily. The encoded protein has been identified as an anchor for tyrosine phosphatase SHP-1, and may induce cell death in myeloid leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

LAIR-1: an inhibitory receptor found on peripheral mononuclear cells, including NK cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region called the leukocyte receptor cluster, which contains at least 25 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: immune system process

Research Articles on LAIR1

Similar Products

Product Notes

The LAIR1 lair1 (Catalog #AAA3216989) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAIR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAIR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LAIR1 lair1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLVLFCLHRQ NQIKQGPPRS KDEEQKPQQR PDLAVDVLER TADKATVNGL. It is sometimes possible for the material contained within the vial of "LAIR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.