Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPSM1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Rabbit GPSM1 Polyclonal Antibody | anti-GPSM1 antibody

GPSM1 Antibody - C-terminal region

Gene Names
GPSM1; AGS3
Reactivity
Cow, Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPSM1; Polyclonal Antibody; GPSM1 Antibody - C-terminal region; anti-GPSM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSS
Sequence Length
675
Applicable Applications for anti-GPSM1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Human: 100%; Mouse: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPSM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPSM1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-GPSM1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Related Product Information for anti-GPSM1 antibody
This is a rabbit polyclonal antibody against GPSM1. It was validated on Western Blot

Target Description: G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal activity of G-protein signaling systems. The protein contains seven tetratricopeptide repeats in its N-terminal half and four G-protein regulatory (GPR) motifs in its C-terminal half. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GPSM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
G-protein-signaling modulator 1 isoform a
NCBI Official Synonym Full Names
G protein signaling modulator 1
NCBI Official Symbol
GPSM1
NCBI Official Synonym Symbols
AGS3
NCBI Protein Information
G-protein-signaling modulator 1
UniProt Protein Name
G-protein-signaling modulator 1
UniProt Gene Name
GPSM1
UniProt Synonym Gene Names
AGS3
UniProt Entry Name
GPSM1_HUMAN

NCBI Description

G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal activity of G-protein signaling systems. The protein contains seven tetratricopeptide repeats in its N-terminal half and four G-protein regulatory (GPR) motifs in its C-terminal half. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

Function: Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from G protein-coupled receptors. Controls spindle orientation and asymmetric cell fate of cerebral cortical progenitors. May also be involved in macroautophagy in intestinal cells. May play a role in drug addiction. Ref.6 Ref.7

Subunit structure: Interacts with GNAI1, GNAI2 and GNAI3 preferentially in their GDP-bound state. May also interact with GNAO1. Interacts with STK11/LKB1 and MACF1

By similarity. Interacts with INSC/inscuteable and FRMPD1. Ref.8 Ref.9

Subcellular location: Cytoplasm › cytosol. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side Ref.7 Ref.9.

Tissue specificity: Expressed in intestinal cells. Ref.7

Domain: The GoLoco domains mediate interaction with G(i/o) alpha

By similarity. The GoLoco domains are essential for the GDI activity toward G(i/o) alpha.

Post-translational modification: Phosphorylation regulates interaction with G(i/o) alpha

By similarity.

Sequence similarities: Belongs to the GPSM family.Contains 4 GoLoco domains.Contains 9 TPR repeats.

Sequence caution: The sequence AAH09979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAH17353.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAB55951.1 differs from that shown. Reason: Frameshift at position 657. The sequence CAI19339.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on GPSM1

Similar Products

Product Notes

The GPSM1 gpsm1 (Catalog #AAA3216827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPSM1 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPSM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPSM1 gpsm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSLPLPVRSR KYQEGPDAER RPREGSHSPL DSADVRVHVP RTSIPRAPSS. It is sometimes possible for the material contained within the vial of "GPSM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.