Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TSN AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellThere is BioGPS gene expression data showing that TSN is expressed in HEK293T)

Rabbit TSN Polyclonal Antibody | anti-TSN antibody

TSN antibody - middle region

Gene Names
TSN; C3PO; RCHF1; TBRBP; TRSLN; BCLF-1; REHF-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSN; Polyclonal Antibody; TSN antibody - middle region; anti-TSN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAG
Sequence Length
228
Applicable Applications for anti-TSN antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TSN AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellThere is BioGPS gene expression data showing that TSN is expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-TSN AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellThere is BioGPS gene expression data showing that TSN is expressed in HEK293T)
Related Product Information for anti-TSN antibody
This is a rabbit polyclonal antibody against TSN. It was validated on Western Blot

Target Description: This gene encodes a DNA-binding protein which specifically recognizes conserved target sequences at the breakpoint junction of chromosomal translocations. Translin polypeptides form a multimeric structure that is responsible for its DNA-binding activity. Recombination-associated motifs and translin-binding sites are present at recombination hotspots and may serve as indicators of breakpoints in genes which are fused by translocations. These binding activities may play a crucial role in chromosomal translocation in lymphoid neoplasms.
Product Categories/Family for anti-TSN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
translin isoform 1
NCBI Official Synonym Full Names
translin
NCBI Official Symbol
TSN
NCBI Official Synonym Symbols
C3PO; RCHF1; TBRBP; TRSLN; BCLF-1; REHF-1
NCBI Protein Information
translin
UniProt Protein Name
Translin
Protein Family
UniProt Gene Name
TSN
UniProt Synonym Gene Names
C3PO
UniProt Entry Name
TSN_HUMAN

NCBI Description

This gene encodes a DNA-binding protein which specifically recognizes conserved target sequences at the breakpoint junction of chromosomal translocations. Translin polypeptides form a multimeric structure that is responsible for its DNA-binding activity. Recombination-associated motifs and translin-binding sites are present at recombination hotspots and may serve as indicators of breakpoints in genes which are fused by translocations. These binding activities may play a crucial role in chromosomal translocation in lymphoid neoplasms. This protein encoded by this gene, when complexed with translin-associated protein X, also forms a Mg ion-dependent endoribonuclease that promotes RNA-induced silencing complex (RISC) activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2012]

Uniprot Description

TSN: DNA-binding protein that specifically recognizes consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. Seems to recognize single-stranded DNA ends generated by staggered breaks occurring at recombination hot spots. Belongs to the translin family.

Protein type: Nuclear receptor co-regulator; DNA-binding; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 2q21.1

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: endoribonuclease activity; mRNA binding; protein binding; DNA binding; sequence-specific DNA binding; protein complex binding; single-stranded DNA binding

Biological Process: gene expression; DNA recombination

Research Articles on TSN

Similar Products

Product Notes

The TSN tsn (Catalog #AAA3216041) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSN antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TSN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSN tsn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVTREAVTEI LGIEPDREKG FHLDVEDYLS GVLILASELS RLSVNSVTAG. It is sometimes possible for the material contained within the vial of "TSN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.