Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SELL AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human, Pig SELL Polyclonal Antibody | anti-SELL antibody

SELL antibody - C-terminal region

Gene Names
SELL; TQ1; LAM1; LEU8; LNHR; LSEL; CD62L; LYAM1; PLNHR; LECAM1
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SELL; Polyclonal Antibody; SELL antibody - C-terminal region; anti-SELL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Sequence Length
372
Applicable Applications for anti-SELL antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SELL AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-SELL AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-SELL antibody
This is a rabbit polyclonal antibody against SELL. It was validated on Western Blot

Target Description: This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-SELL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
L-selectin
NCBI Official Synonym Full Names
selectin L
NCBI Official Symbol
SELL
NCBI Official Synonym Symbols
TQ1; LAM1; LEU8; LNHR; LSEL; CD62L; LYAM1; PLNHR; LECAM1
NCBI Protein Information
L-selectin
UniProt Protein Name
L-selectin
Protein Family
UniProt Gene Name
SELL
UniProt Synonym Gene Names
LNHR; LYAM1; LAM-1; LECAM1
UniProt Entry Name
LYAM1_HUMAN

NCBI Description

This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

SELL: Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia. Belongs to the selectin/LECAM family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23-q25

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: heparin binding; protein binding; protease binding; cell adhesion molecule binding; carbohydrate binding; glycosphingolipid binding

Biological Process: regulation of immune response; cell adhesion; blood coagulation; leukocyte migration; response to ATP

Disease: Iga Nephropathy, Susceptibility To, 1

Research Articles on SELL

Similar Products

Product Notes

The SELL sell (Catalog #AAA3215849) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SELL antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SELL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SELL sell for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSMIKEGDYN PLFIPVAVMV TAFSGLAFII WLARRLKKGK KSKRSMNDPY. It is sometimes possible for the material contained within the vial of "SELL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.