Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACR AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit ACR Polyclonal Antibody | anti-ACR antibody

ACR antibody - C-terminal region

Reactivity
Cow, Horse, Human, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACR; Polyclonal Antibody; ACR antibody - C-terminal region; anti-ACR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWP
Sequence Length
421
Applicable Applications for anti-ACR antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 79%; Human: 100%; Sheep: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACR AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-ACR AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-ACR antibody
This is a rabbit polyclonal antibody against ACR. It was validated on Western Blot

Target Description: Acrosin is the major proteinase present in the acrosome of mature spermatozoa. It is a typical serine proteinase with trypsin-like specificity. It is stored in the acrosome in its precursor form, proacrosin. The active enzyme functions in the lysis of the zona pellucida, thus facilitating penetration of the sperm through the innermost glycoprotein layers of the ovum. The mRNA for proacrosin is synthesized only in the postmeiotic stages of spermatogenesis. In humans proacrosin first appears in the haploid spermatids.
Product Categories/Family for anti-ACR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
49
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
acrosin
NCBI Official Synonym Full Names
acrosin
NCBI Official Symbol
ACR
NCBI Protein Information
acrosin
UniProt Protein Name
Acrosin
Protein Family
UniProt Gene Name
ACR
UniProt Synonym Gene Names
ACRS
UniProt Entry Name
ACRO_HUMAN

NCBI Description

Acrosin is the major proteinase present in the acrosome of mature spermatozoa. It is a typical serine proteinase with trypsin-like specificity. It is stored in the acrosome in its precursor form, proacrosin. The active enzyme functions in the lysis of the zona pellucida, thus facilitating penetration of the sperm through the innermost glycoprotein layers of the ovum. The mRNA for proacrosin is synthesized only in the postmeiotic stages of spermatogenesis. In humans proacrosin first appears in the haploid spermatids. [provided by RefSeq, Jul 2008]

Uniprot Description

ACR: Acrosin is the major protease of mammalian spermatozoa. It is a serine protease of trypsin-like cleavage specificity, it is synthesized in a zymogen form, proacrosin and stored in the acrosome. Belongs to the peptidase S1 family.

Protein type: Protease; EC 3.4.21.10

Chromosomal Location of Human Ortholog: 22q13.33

Cellular Component: protein complex; extracellular region; Golgi-associated vesicle; nucleus; acrosomal matrix

Molecular Function: mannose binding; protein binding; copper ion binding; amidase activity; DNA binding; zinc ion binding; serine-type endopeptidase activity; drug binding; fucose binding

Biological Process: response to steroid hormone stimulus; binding of sperm to zona pellucida; single fertilization; acrosome reaction; adenylate cyclase activation; penetration of zona pellucida; acrosome matrix dispersal; multicellular organism reproduction

Research Articles on ACR

Similar Products

Product Notes

The ACR acr (Catalog #AAA3215846) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACR antibody - C-terminal region reacts with Cow, Horse, Human, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ACR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACR acr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKIDTCQGDS GGPLMCKDSK ESAYVVVGIT SWGVGCARAK RPGIYTATWP. It is sometimes possible for the material contained within the vial of "ACR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.