Western Blot (WB)
(Host: RabbitTarget Name: SNTB2Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlSNTB2 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)
Rabbit SNTB2 Polyclonal Antibody | anti-SNTB2 antibody
SNTB2 Antibody - N-terminal region
Gene Names
SNTB2; SNT3; SNTL; SNT2B2; EST25263; D16S2531E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNTB2; Polyclonal Antibody; SNTB2 Antibody - N-terminal region; anti-SNTB2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ
Sequence Length
267
Applicable Applications for anti-SNTB2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNTB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SNTB2Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlSNTB2 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)
Western Blot (WB)
(Host: RabbitTarget Name: SNTB2Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlSNTB2 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)
Related Product Information for anti-SNTB2 antibody
This is a rabbit polyclonal antibody against SNTB2. It was validated on Western Blot
Target Description: Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.
Target Description: Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.
Product Categories/Family for anti-SNTB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
beta-2-syntrophin
NCBI Official Synonym Full Names
syntrophin beta 2
NCBI Official Symbol
SNTB2
NCBI Official Synonym Symbols
SNT3; SNTL; SNT2B2; EST25263; D16S2531E
NCBI Protein Information
beta-2-syntrophin
UniProt Protein Name
Beta-2-syntrophin
Protein Family
UniProt Gene Name
SNTB2
UniProt Synonym Gene Names
D16S2531E; SNT2B2; SNTL; SNT3; SNTL
UniProt Entry Name
SNTB2_HUMAN
NCBI Description
Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq, Jul 2008]
Research Articles on SNTB2
Similar Products
Product Notes
The SNTB2 sntb2 (Catalog #AAA3215795) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNTB2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SNTB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNTB2 sntb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGEAGASPPV RRVRVVKQEA GGLGISIKGG RENRMPILIS KIFPGLAADQ. It is sometimes possible for the material contained within the vial of "SNTB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
