Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ALDH3B2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit ALDH3B2 Polyclonal Antibody | anti-ALDH3B2 antibody

ALDH3B2 antibody - C-terminal region

Gene Names
ALDH3B2; ALDH8
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ALDH3B2; Polyclonal Antibody; ALDH3B2 antibody - C-terminal region; anti-ALDH3B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQ
Sequence Length
385
Applicable Applications for anti-ALDH3B2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ALDH3B2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-ALDH3B2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-ALDH3B2 antibody
This is a rabbit polyclonal antibody against ALDH3B2. It was validated on Western Blot

Target Description: This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized.
Product Categories/Family for anti-ALDH3B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
222
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Synonym Full Names
aldehyde dehydrogenase 3 family member B2
NCBI Official Symbol
ALDH3B2
NCBI Official Synonym Symbols
ALDH8
NCBI Protein Information
aldehyde dehydrogenase family 3 member B2
UniProt Protein Name
Aldehyde dehydrogenase family 3 member B2
UniProt Gene Name
ALDH3B2
UniProt Synonym Gene Names
ALDH8
UniProt Entry Name
AL3B2_HUMAN

NCBI Description

This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. Altered methylation patterns at this locus have been observed in spermatozoa derived from patients exhibiting reduced fecundity. [provided by RefSeq, Aug 2017]

Uniprot Description

ALDH3B2: a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

Protein type: Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - histidine; Oxidoreductase; Xenobiotic Metabolism - metabolism by cytochrome P450; Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 1.2.1.5; Xenobiotic Metabolism - drug metabolism - cytochrome P450

Chromosomal Location of Human Ortholog: 11q13

Molecular Function: aldehyde dehydrogenase (NAD) activity; aldehyde dehydrogenase [NAD(P)+] activity; 3-chloroallyl aldehyde dehydrogenase activity

Biological Process: ethanol catabolic process; alcohol metabolic process; lipid metabolic process

Research Articles on ALDH3B2

Similar Products

Product Notes

The ALDH3B2 aldh3b2 (Catalog #AAA3215727) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH3B2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH3B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDH3B2 aldh3b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGCGRVAIG GQSNESDRYI APTVLVDVQE TEPVMQEEIF GPILPIVNVQ. It is sometimes possible for the material contained within the vial of "ALDH3B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.