Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP6R3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellPPP6R3 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit PPP6R3 Polyclonal Antibody | anti-PPP6R3 antibody

PPP6R3 antibody - N-terminal region

Gene Names
PPP6R3; SAPL; PP6R3; SAPLa; SAPS3; SAP190; C11orf23
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP6R3; Polyclonal Antibody; PPP6R3 antibody - N-terminal region; anti-PPP6R3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQ
Sequence Length
844
Applicable Applications for anti-PPP6R3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP6R3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellPPP6R3 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-PPP6R3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellPPP6R3 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PPP6R3 antibody
This is a rabbit polyclonal antibody against PPP6R3. It was validated on Western Blot

Target Description: Protein phosphatase regulatory subunits, such as SAPS3, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS3 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.
Product Categories/Family for anti-PPP6R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 6 regulatory subunit 3 isoform 5
NCBI Official Synonym Full Names
protein phosphatase 6 regulatory subunit 3
NCBI Official Symbol
PPP6R3
NCBI Official Synonym Symbols
SAPL; PP6R3; SAPLa; SAPS3; SAP190; C11orf23
NCBI Protein Information
serine/threonine-protein phosphatase 6 regulatory subunit 3
UniProt Protein Name
Serine/threonine-protein phosphatase 6 regulatory subunit 3
UniProt Gene Name
PPP6R3
UniProt Synonym Gene Names
C11orf23; KIAA1558; PP6R3; SAPL; SAPS3
UniProt Entry Name
PP6R3_HUMAN

NCBI Description

Protein phosphatase regulatory subunits, such as SAPS3, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS3 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 612725) (Stefansson and Brautigan, 2006 [PubMed 16769727]).[supplied by OMIM, Nov 2010]

Research Articles on PPP6R3

Similar Products

Product Notes

The PPP6R3 ppp6r3 (Catalog #AAA3215593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP6R3 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP6R3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP6R3 ppp6r3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSQEEDRHSN ASQSLCEIVR LSRDQMLQIQ NSTEPDPLLA TLEKQEIIEQ. It is sometimes possible for the material contained within the vial of "PPP6R3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.