Western Blot (WB)
(Host: RabbitTarget Name: PPP6R3Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PPP6R3 Polyclonal Antibody | anti-PPP6R3 antibody
PPP6R3 Antibody - middle region
Gene Names
PPP6R3; SAPL; PP6R3; SAPLa; SAPS3; SAP190; C11orf23
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP6R3; Polyclonal Antibody; PPP6R3 Antibody - middle region; anti-PPP6R3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEE
Sequence Length
791
Applicable Applications for anti-PPP6R3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP6R3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PPP6R3Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PPP6R3Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPP6R3 antibody
Protein phosphatase regulatory subunits, such as SAPS3, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS3 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.
Product Categories/Family for anti-PPP6R3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 6 regulatory subunit 3 isoform 4
NCBI Official Synonym Full Names
protein phosphatase 6 regulatory subunit 3
NCBI Official Symbol
PPP6R3
NCBI Official Synonym Symbols
SAPL; PP6R3; SAPLa; SAPS3; SAP190; C11orf23
NCBI Protein Information
serine/threonine-protein phosphatase 6 regulatory subunit 3
UniProt Protein Name
Serine/threonine-protein phosphatase 6 regulatory subunit 3
Protein Family
UniProt Gene Name
PPP6R3
UniProt Synonym Gene Names
C11orf23; KIAA1558; PP6R3; SAPL; SAPS3
UniProt Entry Name
PP6R3_HUMAN
NCBI Description
Protein phosphatase regulatory subunits, such as SAPS3, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS3 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 612725) (Stefansson and Brautigan, 2006 [PubMed 16769727]).[supplied by OMIM, Nov 2010]
Research Articles on PPP6R3
Similar Products
Product Notes
The PPP6R3 ppp6r3 (Catalog #AAA3224082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP6R3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP6R3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP6R3 ppp6r3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FEPSSANTED KMEVDLSEPP NWSANFDVPM ETTHGAPLDS VGSDVWSTEE. It is sometimes possible for the material contained within the vial of "PPP6R3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
