Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CDK20 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit CDK20 Polyclonal Antibody | anti-CDK20 antibody

CDK20 antibody - N-terminal region

Gene Names
CDK20; P42; CCRK; CDCH; PNQALRE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDK20; Polyclonal Antibody; CDK20 antibody - N-terminal region; anti-CDK20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVV
Sequence Length
243
Applicable Applications for anti-CDK20 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 92%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CDK20 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-CDK20 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-CDK20 antibody
This is a rabbit polyclonal antibody against CDK20. It was validated on Western Blot

Target Description: The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-CDK20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
cyclin-dependent kinase 20 isoform 5
NCBI Official Synonym Full Names
cyclin dependent kinase 20
NCBI Official Symbol
CDK20
NCBI Official Synonym Symbols
P42; CCRK; CDCH; PNQALRE
NCBI Protein Information
cyclin-dependent kinase 20
UniProt Protein Name
Cyclin-dependent kinase 20
Protein Family
UniProt Gene Name
CDK20
UniProt Synonym Gene Names
CCRK; CDCH; CAK-kinase p42
UniProt Entry Name
CDK20_HUMAN

NCBI Description

The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Dec 2009]

Uniprot Description

CDK20: cyclin-dependent protein kinase H. A CMGC kinase of the CDK family. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Protein type: Kinase, protein; Protein kinase, CMGC; Protein kinase, Ser/Thr (non-receptor); Cell cycle regulation; Motility/polarity/chemotaxis; EC 2.7.11.22; CMGC group; CDK family; CCRK subfamily; CDK/CCRK subfamily

Chromosomal Location of Human Ortholog: 9q22.1

Cellular Component: cytoplasm; nucleus; cilium

Molecular Function: protein binding; cyclin-dependent protein kinase activity; ATP binding

Biological Process: regulation of cell cycle; cell division; multicellular organismal development; cell cycle; protein amino acid phosphorylation

Research Articles on CDK20

Similar Products

Product Notes

The CDK20 cdk20 (Catalog #AAA3215507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK20 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDK20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK20 cdk20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIVFKAKHVE TGEIVALKKV ALRRLEDGFP NQALREIKAL QEMEDNQYVV. It is sometimes possible for the material contained within the vial of "CDK20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.