Western Blot (WB)
(WB Suggested Anti-TIPRL AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellTIPRL is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit TIPRL Polyclonal Antibody | anti-TIPRL antibody
TIPRL antibody - N-terminal region
Gene Names
TIPRL; TIP; TIP41; TIPRL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TIPRL; Polyclonal Antibody; TIPRL antibody - N-terminal region; anti-TIPRL antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIK
Sequence Length
272
Applicable Applications for anti-TIPRL antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TIPRL AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellTIPRL is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-TIPRL AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellTIPRL is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-TIPRL antibody
This is a rabbit polyclonal antibody against TIPRL. It was validated on Western Blot
Target Description: TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6.
Target Description: TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6.
Product Categories/Family for anti-TIPRL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
TIP41-like protein isoform 1
NCBI Official Synonym Full Names
TOR signaling pathway regulator
NCBI Official Symbol
TIPRL
NCBI Official Synonym Symbols
TIP; TIP41; TIPRL1
NCBI Protein Information
TIP41-like protein
UniProt Protein Name
TIP41-like protein
Protein Family
UniProt Gene Name
TIPRL
UniProt Entry Name
TIPRL_HUMAN
NCBI Description
TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 612725) (McConnell et al., 2007 [PubMed 17384681]).[supplied by OMIM, Nov 2010]
Research Articles on TIPRL
Similar Products
Product Notes
The TIPRL tiprl (Catalog #AAA3215453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIPRL antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TIPRL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TIPRL tiprl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQHGSGFGIE FNATDALRCV NNYQGMLKVA CAEEWQESRT EGEHSKEVIK. It is sometimes possible for the material contained within the vial of "TIPRL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
